KEGG   Entamoeba histolytica: EHI_094090Help
Entry
EHI_094090        CDS       T00238                                 

Gene name
349.t00005
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_094090 (349.t00005)
   00052 Galactose metabolism
    EHI_094090 (349.t00005)
Enzymes [BR:ehi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     EHI_094090 (349.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MTTIVKREDFCSIVNGKEVDLYTLTNEFLTINLTNYGCRLIDIITQGKNGPVNVLIGFRS
LKGIMQCDNCMGAIIGRYANRIYKGDLVIDSHKYQLPINNGINCLHGGDGFDKKVFTVTK
ITKTEVVLELDDKDGSNNFPGNVHVVITYKLHENNLVMTFEATTDQTTVVNITNHSYLNL
NGEGSIVHHQLQIYSDQFLPITDEIVPTGEIRKVENTPFDFREFKEIGKEINNDYEQLKL
GSGYDHSFIINENAPHCSWDKSIKQIANIKGDISEVQMSIYSSQPGVQFYTSNFMPEGFK
TRSAFCLETQHFPDSPHHPEFPSTYLKRGDVYHHVCVYQFQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaactattgttaaaagagaagatttttgtagtattgttaatggaaaggaagtagat
ttatatactttaacaaatgagtttttaacaattaacctcactaattatggttgtcgtctt
attgatattattactcaaggaaagaatggtcctgttaatgttttaataggatttcgtagt
ttaaaaggaattatgcaatgtgataattgtatgggagctattattggtaggtatgcgaat
agaatttataaaggagatcttgttattgatagtcataaatatcaattaccaattaataat
ggaattaattgtctccatggaggagatggatttgacaaaaaagtatttacagtaacaaaa
attactaaaacagaagtggtattagaattagatgataaagatgggtctaataattttcca
ggaaatgttcatgttgttataacttataaattacatgaaaataatctagttatgacgttt
gaagcaacaactgatcaaactactgtcgtcaatatcactaatcattcttatttaaattta
aatggagaaggatcaatcgttcatcaccaactccaaatttatagtgatcaatttcttcct
attacagatgaaattgtacctactggagaaataagaaaagttgaaaacacaccatttgat
tttagagagtttaaagaaattggtaaagaaataaataatgattatgaacaattaaaatta
ggaagtggatatgaccattcatttatcataaatgaaaatgctccacattgttcatgggat
aaaagtattaagcaaatagcaaatattaaaggagatataagtgaggtccaaatgtcaatt
tattcatctcaacctggtgttcaattttatacttccaattttatgccagaaggatttaaa
acaagatcagctttttgtttagaaactcaacattttcctgactctccacatcacccagaa
tttccttcaacttatttaaaaagaggagatgtttaccatcatgtttgtgtttatcaattc
caataa

DBGET integrated database retrieval system