KEGG   Entamoeba histolytica: EHI_094090Help
Entry
EHI_094090        CDS       T00238                                 

Gene name
349.t00005
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ehi00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ehi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MTTIVKREDFCSIVNGKEVDLYTLTNEFLTINLTNYGCRLIDIITQGKNGPVNVLIGFRS
LKGIMQCDNCMGAIIGRYANRIYKGDLVIDSHKYQLPINNGINCLHGGDGFDKKVFTVTK
ITKTEVVLELDDKDGSNNFPGNVHVVITYKLHENNLVMTFEATTDQTTVVNITNHSYLNL
NGEGSIVHHQLQIYSDQFLPITDEIVPTGEIRKVENTPFDFREFKEIGKEINNDYEQLKL
GSGYDHSFIINENAPHCSWDKSIKQIANIKGDISEVQMSIYSSQPGVQFYTSNFMPEGFK
TRSAFCLETQHFPDSPHHPEFPSTYLKRGDVYHHVCVYQFQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaactattgttaaaagagaagatttttgtagtattgttaatggaaaggaagtagat
ttatatactttaacaaatgagtttttaacaattaacctcactaattatggttgtcgtctt
attgatattattactcaaggaaagaatggtcctgttaatgttttaataggatttcgtagt
ttaaaaggaattatgcaatgtgataattgtatgggagctattattggtaggtatgcgaat
agaatttataaaggagatcttgttattgatagtcataaatatcaattaccaattaataat
ggaattaattgtctccatggaggagatggatttgacaaaaaagtatttacagtaacaaaa
attactaaaacagaagtggtattagaattagatgataaagatgggtctaataattttcca
ggaaatgttcatgttgttataacttataaattacatgaaaataatctagttatgacgttt
gaagcaacaactgatcaaactactgtcgtcaatatcactaatcattcttatttaaattta
aatggagaaggatcaatcgttcatcaccaactccaaatttatagtgatcaatttcttcct
attacagatgaaattgtacctactggagaaataagaaaagttgaaaacacaccatttgat
tttagagagtttaaagaaattggtaaagaaataaataatgattatgaacaattaaaatta
ggaagtggatatgaccattcatttatcataaatgaaaatgctccacattgttcatgggat
aaaagtattaagcaaatagcaaatattaaaggagatataagtgaggtccaaatgtcaatt
tattcatctcaacctggtgttcaattttatacttccaattttatgccagaaggatttaaa
acaagatcagctttttgtttagaaactcaacattttcctgactctccacatcacccagaa
tttccttcaacttatttaaaaagaggagatgtttaccatcatgtttgtgtttatcaattc
caataa

DBGET integrated database retrieval system