KEGG   Entamoeba histolytica: EHI_095130Help
Entry
EHI_095130        CDS       T00238                                 

Gene name
269.t00003
Definition
phosphatidylinositol 3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ehi  Entamoeba histolytica
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Amoebiasis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    EHI_095130 (269.t00003)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    EHI_095130 (269.t00003)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EHI_095130 (269.t00003)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     EHI_095130 (269.t00003)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1124 aa AA seqDB search
MIELKRSQYVIPSPYRRTTWQGLPLAQLPKRIETKPLSSGIIPSPLSLLKKEDMDEVNEK
KEPRPSNVNVTITQETVFVAVKDRTGKYYGYAMNVNDIGTSIMETCKSNVYIKGDYALVL
PNLNYRVFDEDSRKPLKDLKFVQGCQYHGIVPYFFLVERKAVIQYASVESVGEYLLQSTL
KYEIIGNNFVGLCRNIGDEFYKFRRALATVCGKEEENKKGLDIYLLEENEYVYCGNEPPI
QDLTKKLIMKGYLFEQKMDKTISHLPTDTVENVISALFTKFTTTNQAAFAATEKAEDFVL
KVRGLHEFLIPKKKDGSLYQLCEFDYIRRCVMKHEKIDLYLTPRKVLHQFIGPLNPIDVN
FTGVYNSLLSHDLWEKVETEKAGQSQKSIERNYFITLKKLSNCVYYKPLPQKKNKENKDD
VPVQEYQNIVSFRAYVTAALFLGPRQLGKLVVTPVFQVNNSMATLDNVMEFDLPIKILPK
ETKLVIGVFQTEEQIGVTIDHLEKKEKNKENPIGTINCKVVDHNGMLLMGNVQCGLWELS
APNFISMCSENIGERAIYLTFTYPTYDVPVLMDAFNDDNIKSDNQEKEKLTAEQTKKFKV
ALESNPLQKLTEDEMKLIWKLRYTVKKTKPKNLSRVVAAVDLTDVHAVAELHRLLADWPL
LEPQTAIEMLDFKFPDQRVRDFALKCLDAMDDAELIMFLPQLIQALKFELHHNSELAMFL
LRRALRNKNRIGHQFFWFLKAELHDNRVTERYGLLLEAFVGACGKYQIELYNEVKFQLDL
IDIANHVKTLATKDEQKQYMFEALAKLKYPDNQALPIDSRMRFTKPVPNSGNVFSSKKKP
LLLILQNYDPAGDDIRVIEKVGDDLRQDILTLQILRIMFTMLKNAELDIRMLPYQCIATG
NETGMLELVKDSETYGKIIADDGRRLAVTKNDVLTLWMQKQCARPESKVTFEQAVENFVH
SCAGYCVATYLLGIGDRHSDNVMVTRDGIFFHIDFGHFLGNFKSKFGVKRERTPFKFTQH
YADLMGYKDGVESKEFKEFKELCSSALLSLRKQGSLFIYLFRLMLATGIPELKNEDDIEY
MKNAFMFDEDDQQVKKNFDNMIYQCLDAWSQTLNDLIHDIVHYK
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacttaaacgaagccaatatgtcattccatcgccttatagaagaacaacatgg
caaggattaccccttgctcagttgcctaaaagaattgaaacaaaaccattatctagtgga
ataataccatcaccattatctttactaaaaaaagaagatatggatgaagttaatgaaaaa
aaagagccaagaccatcaaatgttaatgttactattacacaagaaactgtatttgtagct
gtaaaagatagaacaggaaaatattatgggtatgctatgaatgttaatgatattggaact
tccattatggaaacatgtaaaagtaatgtttatattaaaggagattatgcgttggtatta
cctaatttaaattatagggtatttgatgaagactctcgtaaaccacttaaagatttaaaa
tttgttcaaggatgtcagtatcatggtatagttccatattttttccttgtagaaagaaaa
gcagttattcaatatgcatcagtagaatcagttggagaatatttattacaatcaacatta
aaatatgaaattattggtaataactttgttggattatgtagaaatattggagatgaattt
tataaatttagaagagctttagcaactgtttgtggtaaagaagaagaaaataaaaaagga
ttagatatatatttattagaagaaaatgaatatgtttattgtggtaatgaacctcctatt
caagaccttacaaaaaaattaattatgaaaggatatttatttgaacaaaaaatggataaa
actatttctcatttacctactgatactgttgaaaatgttatttctgctttatttactaaa
tttactactacaaatcaagctgcatttgctgctactgaaaaagctgaagactttgtttta
aaagtaagaggattacatgaatttttaattccaaagaaaaaagatggttcattatatcaa
ttatgtgaatttgattatattagaagatgtgttatgaaacatgaaaaaattgatttatat
cttacaccaagaaaagtattacatcaatttattggaccattaaatcctatagatgttaat
ttcactggagtttataattcattattatctcatgatttatgggaaaaagtagaaacagaa
aaagctggacaaagtcaaaaaagtattgaacgtaattatttcattacattaaagaaatta
agtaattgtgtttattataaaccattacctcaaaagaaaaataaagaaaataaagatgat
gttcctgtacaagaatatcaaaatattgttagttttagagcttatgttactgctgcatta
ttccttggaccaagacaattaggaaaattggttgtcacaccagtatttcaagttaataat
agtatggctacattagataatgtaatggaatttgatttaccaataaaaattcttccaaaa
gaaactaaacttgttattggagtatttcaaactgaagaacaaattggtgttacgattgac
catcttgaaaagaaagaaaaaaataaagaaaatcctattggaactattaactgtaaagtt
gttgatcacaatgggatgttacttatgggtaatgttcaatgtggactatgggaattatca
gctccaaatttcatttctatgtgttcagaaaatattggagaaagggctatttaccttact
tttacatatccaacatatgatgtaccagtattaatggatgcatttaatgatgataatatt
aaaagtgataatcaagaaaaagagaaattaactgctgaacaaacaaagaaattcaaagtt
gcattagagtcaaatccattacaaaaattaacagaagatgaaatgaaattaatttggaaa
ttaagatatacagttaagaaaactaaaccaaaaaatctttcaagagttgttgctgcagtt
gatttaactgatgtacatgcagttgcagaattacataggttactagctgattggccatta
ttagaaccacaaacagctattgaaatgttagattttaaattcccagatcaaagggtaaga
gattttgctttaaaatgtcttgatgcaatggatgatgcagaattaattatgttccttcca
caattaattcaagcattaaaatttgaattacatcataatagtgaattagcaatgttctta
ttaagacgagcattaagaaataaaaatagaattggacatcaattcttttggttcttaaaa
gcagaattacatgataatagagttactgaaagatatggattgttattagaagcatttgta
ggtgcatgtggtaaatatcaaatagaattatataatgaagttaaattccaattagacctt
attgatattgctaatcatgttaaaacacttgcaactaaagatgaacaaaaacaatacatg
tttgaagcattagctaaattaaaatatcctgacaatcaagcattaccaattgattctaga
atgagatttacaaaaccagtaccaaatagtggaaatgtatttagtagtaagaaaaaacca
ttattattaatacttcaaaattatgatccagcaggtgatgacattagagtaattgaaaaa
gttggagatgatttaagacaagatatattaacattacaaatattacgtattatgtttact
atgcttaaaaatgctgaattagatattagaatgttaccgtatcaatgtattgctactggt
aatgaaactggtatgttagaacttgttaaagactctgaaacatatggtaaaattattgct
gatgatggaagaagattagcagttactaaaaatgatgtattaacattatggatgcaaaaa
caatgtgctaggccagaaagtaaagttacttttgaacaagcagtagaaaattttgttcat
tcatgtgcaggatattgtgttgctacatatttacttggtattggagatagacatagtgac
aatgttatggtaacaagagacggtatattcttccatatcgattttggacatttccttggt
aatttcaaatcaaaattcggagtaaaaagagaaagaacaccgtttaaatttacacaacat
tatgctgatttaatgggatataaagatggtgttgaaagtaaagaatttaaagaatttaaa
gaattatgttcttctgcattattatcattaagaaaacaaggatcattatttatttatttg
tttagattaatgcttgctactggtattccagaattaaaaaatgaagatgatattgaatat
atgaaaaatgcatttatgtttgatgaagatgatcaacaagttaagaagaactttgacaat
atgatttatcaatgtcttgatgcatggtctcaaacattaaatgatttgatccatgacatt
gtccattacaaataa

DBGET integrated database retrieval system