KEGG   Entamoeba histolytica: EHI_103590Help
Entry
EHI_103590        CDS       T00238                                 

Gene name
85.t00007
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHI_103590 (85.t00007)
   01230 Biosynthesis of amino acids
    EHI_103590 (85.t00007)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_103590 (85.t00007)
   00030 Pentose phosphate pathway
    EHI_103590 (85.t00007)
   00051 Fructose and mannose metabolism
    EHI_103590 (85.t00007)
   00052 Galactose metabolism
    EHI_103590 (85.t00007)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EHI_103590 (85.t00007)
Protein phosphatases and associated proteins [BR:ehi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EHI_103590 (85.t00007)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 436 aa AA seqDB search
MSVKRRDHILIPKNPDAPLPSLKIEEVGECTIDNIYASPEPFVNGMTMKLSAVKNHGIER
DSGEVELAGPMEKIFYNPETTKVAIVTCGGLCPGLNNVIRGLVLNLYNRYHVNNIFGLRW
GYEGLVPELSEVQRLTPEIVSDIHQKGGSILGTSRGAQSPEVMAQFLIDNNFNILFTLGG
DGTLRGANAINKELRRRKVPITVVGIPKTIDNDICYTDSTFGFQTAVGLSQEAINAVHSE
AKSAKNGIGIVRLMGRDAGFIALYASLANGDANLVLIPEIDIPITQICEFVGKRIMSKGH
VVIVVAEGALQNQKPKDLDLGTDKSGNILHWDSINYLRDSITKYLKSIGIEEHTIKFVDP
SYMIRSAPCSAADAHFCMCLANAAVHVAMAGKTGLVICHHHNNFVSVPIDRTSYYIKRVN
TDGPLYTMMTAIEKPK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaagaagagaccatatattaattcctaaaaacccagacgcaccacttcct
tcattaaaaatagaagaagttggagaatgtactattgacaatatttatgcatcaccagaa
ccatttgttaatggtatgacaatgaaattatcagcagtcaaaaatcatggaatagaaaga
gatagtggagaagtagaactagcaggaccaatggaaaagatattttacaatcctgaaaca
acaaaagttgccattgtaacatgtggagggttatgtccaggattaaataatgttatcagg
gggttagtattgaatttatataatcgttaccatgtaaacaatatttttggactaagatgg
ggatatgaaggacttgttccagaattgtctgaagtacaaagactaacaccagaaatagtt
agtgatattcatcaaaaaggaggaagtatattaggaacttcaagaggggcacaaagtcca
gaggttatggcacaatttcttatagacaataactttaatattttgtttacactaggagga
gatggtacattaagaggagcaaatgcaatcaataaagaattaagaagaagaaaagttcca
attaccgttgttggtattcctaaaacaattgataatgatatttgttatactgattctaca
tttggatttcaaacagctgttggactttcacaagaagctattaatgctgttcatagtgaa
gcaaaatcagcaaagaatgggattggaatagttagattaatgggtagagatgctggattt
attgcattatatgcatcattagctaatggtgatgctaatttagtattaattccagagatt
gatattccaattacacaaatctgtgaatttgttggtaaaagaataatgtcaaaaggacat
gttgttattgtagtagcagaaggtgcattacaaaatcaaaaacctaaagatcttgattta
ggaacagataaatcaggaaatattcttcattgggattcaatcaattatttgagagattct
attacaaagtatttaaagtctattggaattgaagaacatacaattaaatttgttgatcct
tcatatatgattagatcagctccttgtagtgctgctgatgcccatttttgtatgtgttta
gctaatgcagcagttcatgtagctatggcaggaaaaacaggattagttatttgtcatcac
cataataattttgtttcagtaccaattgatagaactagttattatattaaacgagttaat
accgatggaccattatatactatgatgacagctattgaaaagccaaagtaa

DBGET integrated database retrieval system