KEGG   Entamoeba histolytica: EHI_104630Help
Entry
EHI_104630        CDS       T00238                                 

Gene name
3.t00014
Definition
filamin 2
Orthology
K04437  
filamin
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 857 aa AA seqDB search
MSQPQWVLTQKKTFTKWANVQLSGAYVINDVETDLNDGLILISLFEALRKQKVQFRYNKK
PKMRVAKLENTEQALNFIKADGVKLVNIDAQNIVDGNLTLILGLLWTLILKYQIAQNKMD
ASKNALLEWVNSKLTSRKIKNFSNDWNTGDVLNELIHALEPDFIDLADSASKGEGEERIQ
YGLSIAEDKMEIPAIIAAEDMALPEPDELSVMAYVSYFRHYEAEKEKRLGEAERLAREAE
LMRTPDPSKCVMSGPGLKTGEVLVPQEFTVTAKNCKGDQITQGGVTWNAHVFDPEGNEIP
IEQKDNGDGTYDMTYVPQVPGKHKVEVAYEDKQLKQSPAIVMIEPAQADPENTYADGEGV
EKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEIPHELVDNNDGTYTGSYV
PVPGIDTVFITLLNQGIKGNPYQCKVFQDPSTACIGESYAFGPGVEGGVTIDKTPVFRIQ
GVTPEGKKCTKGGDEFKVEITDPEGKKQTAKVVDRHNGKYDVKYKAKVPGIYDVQVLLKN
PENPEEFKDIKGSVYHPEIKDGVDAKKCVVDGEGIERPNDQEDNVFTIHAKNFKGEDVPV
GGHPFQVIIDQVTESEKKKKKEGEKSSSSCSSSEEEEDDAEDEELFAFLNDGEEAEQGEE
KAKEEGAEEPKEEEKKEVAEEEPKKEEEEKEEEKKEEGAEEPKEEIEGKKVAQKQQGSIP
CTVIDNENGTYDVHYRAAAGKIRVKIELNKQRVGKSPYHLEVEEDADADESGVENFCFVV
QAKNRRGQVQADGKAKFTVELDGPNGKLEEQKVKVKHLGEGKYFIRYSLPAEKGEYHINC
KLNRRHIAGSPFKQTVN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaccacaatgggttcttacccaaaagaaaacatttactaaatgggcaaatgtc
caattaagtggagcatatgttataaatgatgttgagactgatttaaatgatggattgatc
ttaatatcattatttgaagctttaagaaaacaaaaagtacaattcagatataataagaaa
ccaaagatgagagtagctaaattagaaaatacagaacaagcattaaatttcattaaagct
gatggagttaaattagttaatattgatgctcaaaatattgttgatggaaatttaacactt
attcttggacttctttggacacttattcttaaatatcaaattgctcaaaacaaaatggat
gcatcaaagaatgcattacttgaatgggttaactcgaaattaacatcaagaaaaattaaa
aacttctcaaatgattggaatacaggtgatgtattaaatgaattaattcatgctcttgaa
ccagactttattgatttagctgattcagcatcaaaaggagaaggagaagaaagaattcaa
tatggattaagtattgcagaagataaaatggaaattccagcaattattgcagcagaagat
atggcacttccagaacctgatgaattatctgttatggcatatgtttcttatttcagacat
tatgaagctgaaaaagaaaagagattaggagaagctgaaagacttgcacgtgaagcagag
ttaatgagaacaccagatccatcaaaatgtgttatgtcaggacctggacttaaaacagga
gaagttcttgtaccacaagaatttactgttacagctaagaattgtaaaggagaccaaatt
acacaaggaggagttacatggaatgcacatgtatttgatccagaaggaaatgaaattcca
attgaacaaaaagataatggagatggaacatatgatatgacatacgttccacaagtacca
ggaaaacataaagttgaagttgcatatgaagataaacaattaaaacaatcaccagctatt
gttatgattgaaccagcacaagcagatccagaaaatacatatgcagatggagaaggtgta
gagaaatgtgatgcaggaaaaggaccagttaagtttaccattcattgtgtaaataaagtt
ggaacagctgtaccagttactggagctaagtttaaagttatcattagatctaatgatgga
aatgaaattccacatgaacttgttgataataatgatggtacttatacaggaagttatgtt
ccagttccaggaattgatactgttttcattacattattgaatcaaggaattaaaggaaat
ccatatcaatgtaaagtcttccaagatccatctactgcatgtattggagaatcatatgca
tttggaccaggtgttgaaggaggagttactattgacaaaacaccagtatttagaattcaa
ggagttacaccagaaggaaagaaatgtactaagggaggagatgaatttaaagttgaaatt
acagatccagaaggaaagaaacaaacagcaaaggttgttgatagacataatggtaaatat
gatgttaaatataaggctaaagttccaggtatttatgatgttcaagttcttttgaaaaat
ccagagaacccagaagaatttaaggatattaaaggatcagtttatcatccagaaattaag
gatggagttgatgctaagaaatgtgttgttgatggagaaggtattgaacgaccaaatgat
caagaagacaatgtctttactattcatgctaagaactttaaaggagaagatgttccagtt
ggaggacatccattccaagttatcattgatcaagtcacagaaagtgaaaagaagaagaaa
aaagaaggagaaaagtcatcaagcagttgttcatcttctgaggaagaggaagatgatgca
gaagatgaagaattgtttgcattcttgaatgatggagaagaagcagaacaaggagaagaa
aaagcaaaagaggaaggagcagaagaaccaaaagaagaggaaaagaaagaagttgcagaa
gaagaaccaaagaaggaggaagaagaaaaagaagaagaaaagaaagaggaaggagcagaa
gaaccaaaagaagaaattgaaggaaagaaggtagcacaaaaacaacaaggaagtattcca
tgtactgttattgataatgaaaatggaacatatgatgttcattatagagctgctgcaggt
aagattagagtcaagatagaattaaataaacaaagagttggtaaatcaccatatcatctt
gaagttgaagaagatgctgatgcagatgaatcaggagttgaaaacttctgctttgttgtc
caagctaagaatagaagaggacaagtccaagctgatggaaaagctaaattcacagttgaa
cttgatggaccaaatggtaagcttgaagaacaaaaagttaaagttaaacaccttggagaa
ggaaaatatttcattcgatattctcttccagcagaaaaaggagaatatcatattaactgt
aagttgaacagaagacatattgctggatcaccatttaaacaaacggtcaattaa

DBGET integrated database retrieval system