KEGG   Entamoeba histolytica: EHI_106090Help
Entry
EHI_106090        CDS       T00238                                 

Gene name
448.t00005
Definition
starch branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ehi  Entamoeba histolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EHI_106090 (448.t00005)
Enzymes [BR:ehi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     EHI_106090 (448.t00005)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EHI_106090 (448.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 680 aa AA seqDB search
MSTKLQMIVDDPYLEPFAATIYGRQKKTLDVLSKIEHNEGSLEEFANSYKRYGLNRTVQK
ENGKEVEGWSIREWAPNFKEMYLFGDFNNWDRATAIKLTRDEFGTHNGFIPDENGESKIK
HLSKIKVFGITYSGERLDRIPTYHRYCVLNPKTSSMEAVVYNPEHPYNPTSPKPKIPSAL
KIYESHVGICTPEKKIASYDEFRERIVPYCKKVGYNAIQLMAIMEHPYYASFGYQVTNFF
AASSRFGTPDALKYLIDECHKEGIIVLLDIVHSHTSANVVDGINMFDGSDGHYLLPGEQG
KHPLWGSRLFNYNNYETLRFLLSNVKYYAEEFGFDGFRFDGVTSMIYTHHGVGAHTFDYA
HYFGPNANEDALTYLSLVNILVHRKSMNCVTIAEDVSGYAGLCRTFEDGGIGFDYRLAMS
CPDLWIEYLKTKKDEDWNVNHIGFVLNNRRWKEKAIAYAECHDQALVGDKTISFWLMDKE
MYTGMSCLWQPSLVIDRGIALHKMIRLVTCMLGGEGYLTFMGNEFGHPEWLDFPREGNGD
SFHYCRRQYNLVEDHLLRYKFLLAFEREMLHLEDQYPWLNKPNAYISKHNEGDHVLAFQR
GEVIGVFNFHYEKSFTGYGIGVKEPGTYKIILNSDSSEFGGYDRITSQEYVSQPIECDGL
PNQIQIYIPCRVAIVLTKIN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaattacaaatgattgtagatgatccatatcttgaaccatttgctgcaaca
atttatggaagacaaaagaaaacacttgatgttctttcaaaaatagaacataatgaagga
tcattagaagaatttgctaattcatacaaacgatatggattaaatagaacagtacaaaaa
gaaaatggaaaagaagtagaaggatggagtattagagaatgggcacctaattttaaagaa
atgtatttatttggagattttaataattgggatagagccacagctattaaattaactcgt
gatgaatttggaacacacaatgggtttattccagatgaaaatggagaatctaaaattaaa
catttaagtaaaataaaagtatttggtatcacatattctggagaacgattagatagaatt
cctacatatcatagatattgtgttcttaatcctaagacatcatcaatggaagctgttgtt
tataatccagaacatccatataatcctacatcaccaaaaccaaaaattccaagtgcatta
aaaatatatgaaagtcatgttggaatttgtacaccagaaaagaaaatagcaagttatgat
gaatttagagaaagaattgttccatattgtaaaaaagttggatataatgcgattcaatta
atggctattatggaacatccatattatgcatcttttggatatcaagttacaaatttcttt
gcagcatcatcacgatttggaacacctgatgcattaaaatatttaattgatgaatgtcat
aaagaaggaattattgtattattagatattgttcattcacatacatctgcaaatgtagtt
gatggaattaatatgtttgatggaagtgatggacattatttacttccaggagaacaagga
aaacatccattatggggatcaagattatttaattacaacaattatgaaacattaagattt
ttattgtctaatgttaagtattatgcagaagaatttggatttgatggatttagatttgat
ggagtaacttctatgatttatactcatcacggtgttggagcacatacttttgattatgca
cattattttggtccaaatgcaaatgaagatgcattaacttatttgtcattagttaatatt
cttgttcatagaaaaagtatgaattgtgttactatagctgaagatgtatcaggatatgca
ggattatgtagaacatttgaggatggaggaattggatttgattatagacttgctatgtca
tgtccagatctttggatagaatatttaaaaacaaagaaagatgaagattggaatgtaaac
catattggatttgtattaaataatagaagatggaaagaaaaagctattgcttatgcagag
tgtcatgaccaagcattggttggagataaaactatttcattttggttaatggataaagaa
atgtacactggaatgtcatgtttatggcaaccatcattagttattgatagaggaattgct
ttacataaaatgattcgattagtaacatgtatgttaggaggagaaggatatttgacattt
atgggaaatgaatttggacatcctgaatggcttgatttcccaagagaaggaaatggtgat
tcattccattattgtagaagacaatataatttggttgaagaccatttgttaagatataaa
tttttattggcttttgagagagaaatgcttcatttagaagatcaatatccatggttaaat
aaaccaaatgcttatatttcaaaacataatgaaggggatcatgttttagctttccaacga
ggtgaagttattggagtttttaatttccattatgaaaagagttttacaggatatggaatt
ggagtaaaagaaccaggaacatataaaatcatattaaattctgattcatcagaatttgga
ggatatgatagaattacttctcaagaatatgtctctcaaccaattgaatgtgatggatta
ccaaatcaaattcaaatttatattccttgcagagttgctattgttttaaccaaaataaat
taa

DBGET integrated database retrieval system