KEGG   Entamoeba histolytica: EHI_106670Help
Entry
EHI_106670        CDS       T00238                                 

Gene name
217.t00005
Definition
calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ehi  Entamoeba histolytica
Brite
Protein phosphatases and associated proteins [BR:ehi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     EHI_106670 (217.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 179 aa AA seqDB search
MGNTLSGLKQEDVEQMMATTNFTESELRRLFRRFKKLGMKAKEGASEEYDDLAELTSNPV
LQRLLEIFNRYENEEVQFSQFVATLSTLSDKGSQEAKLRFAFQVYDVDNDGFISNPELFK
VLKMIIGSSFTDEQLQQVVDKTIIEADKDRDGKISYEEFCSIILKNSENIGEKLTINWQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacaccctctctggattgaaacaagaagatgttgaacaaatgatggctacaacc
aacttcactgaaagtgaattaagacgtttattccgtcgttttaaaaaattgggaatgaaa
gctaaagaaggtgcctctgaagaatatgatgaccttgctgaattaacttctaacccagtt
cttcaaagacttcttgaaatcttcaatcgttatgaaaatgaagaggtacaattctctcaa
tttgttgcaaccctttcaaccctttctgataaaggaagtcaagaagcaaaacttagattt
gctttccaagtgtatgatgttgataatgatggttttatatcaaatccagaactattcaaa
gttcttaaaatgattattggtagttcttttactgatgaacaattacaacaagtggttgat
aaaactattatcgaagctgacaaggatagagacggaaagatttcatatgaagaattctgc
agtattatcttaaagaactctgaaaatattggagaaaaacttaccattaattggcaataa

DBGET integrated database retrieval system