KEGG   Entamoeba histolytica: EHI_109900Help
Entry
EHI_109900        CDS       T00238                                 

Gene name
128.t00012
Definition
profilin
Orthology
K05759  
profilin
Organism
ehi  Entamoeba histolytica
Brite
Exosome [BR:ehi04147]
 Exosomal proteins
  Proteins found in most exosomes
   EHI_109900 (128.t00012)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MTWQEYVDVELIGSGYCKSAVIIGMDGTENAVSLHCHLEKNEIANLISLFGDSKKRQTGM
KIKLKGTGCIIQYGGDRTITAMSEKEDEGFVIVKTKQVIIVATYGDYMKEEQCLLVVEKL
ADYLIQKGF
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacatggcaagaatatgtagatgttgaattaattggttctgggtattgtaaaagtgct
gtaataattgggatggatggaactgaaaatgcagtttcacttcattgccatttagaaaag
aatgaaattgcaaatttaatatcattgtttggtgattccaagaagagacaaacaggaatg
aaaataaaacttaaagggacaggatgtattattcaatatggaggtgatagaacaattact
gccatgtcagaaaaagaagacgaaggttttgttattgtaaaaacaaaacaagtaataatt
gttgcaacatatggagattatatgaaagaagaacaatgccttttggttgttgaaaaatta
gctgattatctaattcaaaaaggtttttag

DBGET integrated database retrieval system