KEGG   Entamoeba histolytica: EHI_118780Help
Entry
EHI_118780        CDS       T00238                                 

Gene name
62.t00017
Definition
WD domain containing protein
Orthology
K14298  
mRNA export factor
Organism
ehi  Entamoeba histolytica
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ehi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MSKQQSNSPVFPLGEPKTFQDTISGIEGYSSQNGILVGVSSWDKTCKAFLVNSPTQTQIV
GSVNCNSPLTSICKFCKFCESQFLVGSLNGGVYLWNVQQNSLQQVGQFNDCITSMKPFPE
TNSIVISSLDGSLGLLDLNSGNISKMPVNNKIICMDAKYPYITFHTPNKVEVFNIQSGKL
MTDTLIGGQQSTVNSSVQCIAVFPDRKGIVYGGADGRANVLHFENKSNQYTYAFKAQHKK
ISTTQTYYYPVNSISFYNETIFLTAGSDGVINIWDKNKKSLVNTLTSPIQNCPITTADFI
CENKFLAYSVGYDWHQGVEGLLQQQVSVPVIKVVDDPLVRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacaatcaaattcaccagtttttccattaggagaaccaaaaacattccaa
gacactatcagtggtattgagggatacagttcacaaaatgggattttagttggagtatca
tcatgggataaaacatgtaaagcatttttagttaattccccaacacaaacacaaattgtt
ggaagtgttaattgtaactcaccattaacttctatatgtaaattttgtaaattttgtgaa
tcacaatttttagttggatcacttaatggaggagtatatttgtggaacgttcaacaaaat
tcactacaacaagtaggacaattcaatgattgtataacctctatgaaaccatttcctgaa
actaattctattgttatttcaagtttagatggatcattaggattactcgatttaaattca
ggtaatatttcaaaaatgccagtaaataataaaattatttgtatggatgcaaaatatcct
tatattactttccatactccaaataaagtagaagtatttaatattcaatcaggtaaatta
atgacagacactcttattggaggacaacaatctactgttaattcaagtgttcaatgtata
gcagtattccctgatagaaaaggtattgtatatggtggtgctgatggaagagcaaatgtt
cttcattttgaaaacaaaagtaaccaatatacctatgcatttaaggctcaacataaaaaa
atatcaacaactcaaacatattattatcctgttaattcaatttcattttataacgaaaca
atatttcttactgctggtagtgatggtgtgattaatatttgggataaaaataagaaaagt
cttgttaatactttaacttctcctattcaaaattgtccaataactactgccgattttatt
tgtgaaaataaatttttggcttactcagttggatatgattggcaccaaggagtagaagga
cttcttcaacaacaagtatcagttcccgtaattaaagtagtagatgatcctttagttcgt
ttatga

DBGET integrated database retrieval system