KEGG   Entamoeba histolytica: EHI_118910Help
Entry
EHI_118910        CDS       T00238                                 

Gene name
62.t00003
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ehi  Entamoeba histolytica
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EHI_118910 (62.t00003)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EHI_118910 (62.t00003)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MGKYQVLVLFGPSGAGKSTIMHHLMEKFPGKFSFSISHTTRKPRGKEQNGVDYYFIEEEE
MKKMIEEDKFIEHAHVHTAFYGTSKMEIERIANNNQIAILDIDLQGSRQIRGKVAAFFLF
IAPPSMEILEQRLRSRGTETEEQVQVRLKNALIEMEGEKEADAVVVNNVFTEGYGKIDEI
IEKNLF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatatcaggttcttgttctttttggtccaagtggagcaggtaaatcaacaata
atgcaccatcttatggaaaaatttcctgggaaattttcatttagtatttcacacacaaca
agaaaaccaagaggtaaagaacaaaatggtgttgattattactttattgaagaagaagaa
atgaagaaaatgattgaagaagataaatttattgaacacgcccatgttcatacagccttc
tatggtacttcaaaaatggaaattgaacgcattgctaataataatcaaattgcaattctt
gatattgatcttcaaggaagtagacaaattagaggtaaagtggcagcattctttttgttt
attgcacctccttcaatggaaattttagaacaacgtttacgttcaagaggtacagaaaca
gaagaacaagtccaagttcgtttaaagaatgcacttattgaaatggaaggagaaaaagaa
gcagatgcagtagttgtgaataatgtattcacagaaggatatggtaagatagatgaaatt
atagaaaagaatttgttttaa

DBGET integrated database retrieval system