KEGG   Entamoeba histolytica: EHI_119320Help
Entry
EHI_119320        CDS       T00238                                 

Gene name
232.t00006
Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 448 aa AA seqDB search
MSRVCYFYDQNVGEFDYGFGHPMKPLRNKLVHHLIMEYGIYKRLNIYKPWRATNEQMEMF
HSKEYIDFLQRVTPEMALQPHFKKSLEEFNFTDDCPVFEGLYPFVQTVVGSSLGCAMKIN
ERAADICVNWSGGLHHAKKSQASGFCYINDIVCAILELLKVHSRVLYIDIDHHHGDGVEE
AFKATNRVMTFSLHKYGDNYFPGTGDVDEVGIDEGKNYSINVPLKDGINDEGYHRLFYPI
IDRIMEVFQPSVVVMQCGADSLNGDRLGFFNLSIQGHCDCMKYVKKFGLPMILVGGGGYT
VSNTARCWCYETAAACDLNIPDQIPINDYLEYYVPDMKITISTNPQMKNCNSRNYIEDIL
NKVMAILEEVGNSNLPIVQFTNPPRIDEHTIEMEIDEDQQDFNDVSNGFIRDIPLNIDSD
EVIKMYTEPLPIYPKSKLFCTENFKEFE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgagtgtgttatttctatgatcaaaatgttggagaatttgattatggatttgga
catccaatgaaaccattaagaaataaattagtacatcacttaattatggaatatggaata
tacaaacgactaaatatttataaaccatggagagcaacaaatgaacaaatggaaatgttc
cattctaaagaatatattgattttttacaaagagttacaccagaaatggcattacaacct
cattttaaaaagtcattagaagaatttaattttacagatgattgtccagtttttgaagga
ttatatccatttgttcaaacagttgtaggaagttcattaggatgtgctatgaaaattaat
gaaagagcagcagatatttgtgtaaattggtcaggaggattacatcatgcaaagaagtca
caagcatcagggttttgttatattaatgatattgtatgtgctatattagaattacttaaa
gttcattcaagagtactttatattgatattgatcatcatcatggagatggagttgaagaa
gcatttaaagctacaaatagagtaatgacattttcattacataaatatggagataattat
tttcctggaacaggagatgtagatgaagttggaattgatgaaggcaagaattatagtatt
aatgtaccattaaaagatggaattaatgatgaaggatatcacagattattttatccaata
atagatagaattatggaagtttttcaaccaagtgtagttgtaatgcaatgtggagcagat
agtttaaatggagatagattaggattttttaatttatcaattcaaggacattgtgattgt
atgaaatatgttaaaaaatttggacttccaatgattcttgttggaggaggtggatatact
gtatctaatactgcaagatgttggtgttatgaaacagcagcagcttgtgatttaaatatt
cctgatcaaattccaattaatgattatttagaatattatgttcctgatatgaaaatcact
atttctacaaatccacaaatgaaaaattgtaatagtagaaattatattgaagatatatta
aataaagtaatggcaattctcgaagaagtaggaaattctaatttacctattgttcaattt
actaatccacctcgtattgatgaacatacaatagaaatggaaatagatgaagaccaacaa
gattttaatgatgtttctaatggatttattagagatataccattaaatatagattcagat
gaagtaataaagatgtacactgaaccattaccaatttatccaaaaagtaagttattctgt
actgaaaatttcaaagaatttgaataa

DBGET integrated database retrieval system