KEGG   Entamoeba histolytica: EHI_124620Help
Entry
EHI_124620        CDS       T00238                                 

Gene name
42.t00003
Definition
hypothetical protein
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1575 aa AA seqDB search
MNKPQSINFEALDDNCPPEQLPESWKIILREAGVKKKDLQNPETRKKVYAYMRQSVYVKK
TQEELDKQKVSAHDVRRMSVSVKQRYKVIEGKQRIQPNFVSAKPQTDVKQSSFLSTRQPH
MKSPNTTPQHQTQSSSVTSTKTTQALFQKTSTSPSIKFGQTPTKQQTNVENSPTRIKTPE
KPTLTNSKSPESQQLITPKPTGYGSKTPSSLTTQPKLQTKSNSMFSKKSVKPTTTSSTTN
KPSSTSTPTVSTPSSNNESSTQKSQNSSSFAPHAFGSKIDTSAKSGSVNNPTHFVSNPQP
QPITKKSFTTPSSSTLKQTTPSQPQSSSMNSFNKSSVVKQTTTASVNTSKPLTPKSPTSS
LNENKVSTGSHINSTISSPIKQTQPTTSQTLQTRKQSLTPSHQISAEQMKQPLVKTSTNT
QKQQPSISKQESFSSQRVAKSPEPTLKDMSQNVSKSTEPAKTNTTVKGIQKQSNIPVKET
ESSTVQETIKSPKTQQPNIEKPIVSNHQSTASQPKLLVNLKSSPTSSSPSNTNNSDKEKV
DLSKMSFVQRQRYLREQQDLEAQKTSVTRNVVKPTPSFKKSATQSSTIEEKQKEGMKQET
NQQTEEVDLSKMTFVQRQRWEREQQDKRAEQTTAKSHGYEAKFAKQTSTPKDIVYQDSRE
DINGVNKELQQGNEEDQCVKPSSMGLKSSAAQIVAQRKKLPKSGKNNTLTGSASLNAYIQ
RQEQYKQDEIEREKIRMEMQRKREEIQRKQDEIRKMREETEKQHKKGEERLKQEEERFKK
EEEERKKKEEERLRQEEEENKRIKEERQRKEEELRKKKAEEERKRKLEEEARKRKEEEEQ
RKEEEEKRKVEEELKKKEEEERKRKEAIELKKKQLEEERKKKEEERKKREEEERKKEEEE
ERLKQIEQEKQRKLEEERKKKEEAIKRKKEEEERKRKEEERRKREEAERKRKEEEERKRK
EEEAKRKIEQERQRKIEEERRKKEEEEQRRLEEEKKLLEEEQKRLEEEERKAEEERKRVE
AERKRKEEEERKRKEEEERKRKEEERKRKEEEERKRKEEEEKRKKELEELKKLKEEERRK
KEEELKRKQEEEKRKAEAERKRKEEEERKRKEEEERKRKEEEKRKAEEERKRKEEELRKK
KEAEEKKRKLEEEHKKKEEELRKKKEEEEKRRQEEEKRKAEEERKRKEEEEKARKEEEER
IKREEEERKKQEEEERKKKEEEELRVKQEEEKKKRAEEEEKRRRAEERKRKEEEARKKEE
EEVERLKKELEEEERKLKEAEEERKRIEAERKRKEEEKKKREEEEKRKREEEERKRKEEE
EKARKEEEEKRKREDEERMRRHEEERRKWEEEQKARMAEFEEMKREAERLRQEAARLKEE
EERLKQEAERLKKEKEETERFKASLLDSSAKTSSPSSIATPPPPPPTLSMPPPPPPTLSM
PPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTLNV
TSSPTTTMTPSSGATLSLAEMIAAKQGKLKATEIEERVVQEDEVVLALRGILTARRQDTN
ISSDEEEEDDDDWSE
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccacaaagtattaactttgaagcacttgatgataactgtcctccagaacaa
ttaccagagtcatggaaaattatattaagagaggctggtgttaaaaagaaagaccttcaa
aatccagaaacaagaaagaaagtatatgcttatatgagacaatcagtttatgttaaaaaa
actcaagaagaattagataaacagaaagtctctgctcatgatgttagaagaatgtctgtt
tctgtaaaacagagatataaagtcatagaaggaaaacaaagaatacaacccaactttgtt
tctgctaaaccacaaactgatgttaaacaaagttctttcttaagtacaagacaaccacat
atgaaatcaccaaatactactcctcaacaccaaacacaatcatcttctgtgacttcaaca
aaaacaacacaagctttgtttcaaaaaacttctacttctccatcaataaaatttggtcaa
acaccaactaaacaacaaactaatgtagaaaattctcctaccagaataaaaactccagaa
aaaccaacacttactaactcaaaaagtcctgagtcccaacaactaataacacctaaacct
actggttatggttctaaaactccttcgtctttaacaacacaacctaaattacaaacaaaa
tctaatagtatgttttcaaaaaaatcagttaaaccaacaactacatctagtacaacaaat
aaaccttctagcacatcaacacctactgttagtacaccttctagtaataatgagtcatca
actcaaaaatcacaaaactcatcctcatttgctcctcatgcttttggttcaaaaattgat
acgtctgcaaagtcaggatcagttaataatcccactcactttgtttctaatcctcaacca
caacctattacaaaaaaatcatttacaacaccatcttcttctacccttaaacaaacaaca
ccatcacaaccacaaagctcttcaatgaactcatttaataaatcaagtgtagttaaacaa
actactactgcttcagttaatactagtaaaccactaacacctaaatcacctacatcatct
ttgaatgaaaataaagtatcaacaggttctcacatcaactctactatatcatctccaatt
aaacaaacacaaccaacaacatcacaaactcttcaaacaagaaagcaatcactaacacct
tctcatcaaataagtgctgaacaaatgaaacaaccattagttaaaacgtcaactaatact
caaaaacagcaaccaagtatttctaaacaagagtctttttcttcacaacgagttgctaaa
tcaccagagccaaccttgaaagatatgtctcaaaatgtttctaaatccactgaacctgct
aaaacaaatactacagttaaaggaatacaaaaacaaagtaatattcctgttaaagaaaca
gaatcatccactgtacaagaaactattaaatcaccaaaaactcaacaacctaacattgaa
aaacctatagtatctaaccaccaatctactgctagccaacctaaattattggtaaatctt
aaatcatcacctacaagctcatctccatcaaatacaaataatagtgataaagaaaaagtt
gatttatctaaaatgtcatttgtccaaagacaacgatatttgagagagcagcaagactta
gaagcacaaaaaacttctgtaacacgtaatgttgttaagccaactccttcattcaaaaag
tctgcaacacaaagcagcactattgaagaaaaacaaaaggaaggcatgaaacaagaaact
aatcaacaaactgaagaagttgatttgtctaaaatgacatttgtccaacgacaacgctgg
gaaagagaacaacaagataagagagcagaacaaacaactgcaaaatcacatgggtatgaa
gcaaagtttgctaaacaaacatcaactcctaaagacattgtttatcaagacagccgtgaa
gatataaatggtgttaacaaagaactacaacagggtaatgaagaagaccaatgtgtcaaa
ccttctagtatgggactcaagtcaagtgcggctcaaattgtggctcaaagaaaaaaatta
ccaaagagtggaaagaacaatactttgacaggatcagcatcacttaatgcttatatccaa
agacaagaacaatacaaacaagatgaaattgaaagagaaaaaatacgtatggaaatgcaa
agaaaacgtgaagaaattcaaagaaaacaagatgaaattagaaagatgagagaagaaact
gaaaaacaacataagaaaggagaagagagattaaaacaagaagaagaacgattcaagaaa
gaagaggaagaaagaaagaaaaaggaagaagaacgtttacgacaagaagaagaagagaac
aaaagaattaaagaagaaagacaacgtaaagaagaggaattgagaaaaaagaaagctgaa
gaagaacgaaagagaaaattagaagaagaagcacgtaaacgaaaagaagaagaagaacaa
agaaaagaagaagaggaaaagagaaaagtagaagaagagttaaagaagaaagaagaggaa
gaaagaaaaagaaaagaagctattgaactgaaaaagaaacaacttgaagaagaacgtaaa
aagaaagaagaagaaagaaagaaaagggaagaagaagaacgtaaaaaagaagaagaggaa
gaacgactcaaacaaattgaacaagaaaaacaaagaaaacttgaagaagaacgtaaaaag
aaagaagaagcaattaaacgtaaaaaggaagaagaagaacgtaagagaaaagaagaagaa
agacgtaagcgtgaagaggctgaaagaaaaagaaaggaagaagaagaacgtaagagaaaa
gaagaagaggctaaaagaaaaattgaacaagaaagacaaagaaaaattgaagaagaacga
agaaaaaaagaagaagaagaacaaagaaggcttgaagaagagaaaaaattattggaagaa
gaacaaaagagattagaagaagaagaaagaaaggcagaagaagaaagaaaacgtgttgaa
gctgaaagaaaaagaaaggaagaagaagaacgtaagagaaaagaagaggaagaaagaaaa
agaaaagaagaagagcgtaagagaaaggaagaagaagaacgtaagagaaaagaagaggaa
gaaaagagaaagaaagaactagaggaattaaaaaagttaaaagaagaagagcgtagaaag
aaagaagaagaattaaagagaaaacaagaagaagagaaacgtaaagctgaggcagaaaga
aaaagaaaagaagaagaggaacgtaagagaaaggaagaagaagaacgtaagagaaaagaa
gaagaaaaacgtaaagccgaagaagaaagaaagagaaaagaggaggagttaagaaagaag
aaagaggcagaagagaagaaaagaaaacttgaagaagaacacaagaaaaaagaagaggaa
ttaagaaagaagaaggaagaagaagaaaaacgacgacaagaagaagaaaaacgtaaagcc
gaagaagaaagaaagagaaaagaagaagaagaaaaggcgagaaaagaagaagaagagaga
attaaacgggaagaagaagaacgtaagaaacaagaagaagaagaacgtaagaagaaagaa
gaagaagagcttagagttaaacaagaagaagaaaagaaaaaaagagcagaagaagaagag
aaacgacgaagagcagaagaaagaaagagaaaggaagaagaggcacgtaaaaaagaagaa
gaagaagttgagagattaaagaaagaacttgaagaagaagaacgtaaattaaaagaagct
gaagaagaaagaaaacgtattgaagctgaaagaaaaagaaaagaagaagaaaagaaaaaa
agagaagaagaggaaaaacgaaagagagaagaagaggaaagaaaaagaaaagaagaagaa
gagaaagcgagaaaagaagaagaggaaaaacgaaagagagaagatgaagaaaggatgaga
cgacacgaagaagaaagaaggaaatgggaagaagaacaaaaagcaagaatggctgagttt
gaagaaatgaaacgtgaggcagaaaggttaagacaagaagcagcacgtttgaaagaagaa
gaagaacgattgaaacaagaggctgaaagacttaaaaaagaaaaagaagaaaccgaaagg
tttaaagcatctttgttagattccagtgcgaaaacatcctctccatcatcaattgctaca
ccaccaccacctcctccaacattgagcatgccaccaccacctcctccaacattgagcatg
ccaccaccacctcctccaacattgagcatgccaccaccacctcctccaacattgagcatg
ccaccaccacctcctccaacattgagcatgccaccaccacctcctccaacattgagcatg
ccaccaccacctcctccaacattgagcatgccaccaccacctcctccaacattaaacgta
acaagttcaccaacaactacaatgacaccaagttctggtgcaactctgtcattagcagaa
atgattgcagctaaacaaggtaaattaaaggcaactgaaattgaagaacgagtggtccaa
gaagatgaggttgttttagcattaagaggaattcttaccgcaagaagacaagacactaat
atttcttctgatgaagaagaagaagatgacgatgactggagcgaataa

DBGET integrated database retrieval system