KEGG   Entamoeba histolytica: EHI_137730Help
Entry
EHI_137730        CDS       T00238                                 

Gene name
64.t00009
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     EHI_137730 (64.t00009)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHI_137730 (64.t00009)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 340 aa AA seqDB search
MSFLTLFNTSKIKGTNGLYNLGNTCYMNAVIQCIAHTKQFLEYSLQYQLKVYINENNTKC
SLIENVTESLIKTIQTLYTRKESIYPQYFFTTFGIYNQQFSDKKQKDAAEFLLLLLDVMD
NDLRGTSIIQPPPIIHNEVYYKDYIEYIKNNKSIITQMTTGIVVSNFCCEICGISSTHSE
PFSLLQLPIIKNLSFFKKVNFKNYSELKELKYITIYDCLIGYLYSFQTCVNCNHTQIHNK
EFVVTPPILIIQILRFEQHSNNTQKDQTTILFPLNDFVIGVTKYQLYATIDHTGSINHGH
FTANCKINNLWYHFDDETVKPLNKIDIVSKKSYILFYERI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttttaactttgttcaatacatcaaaaattaaaggaacaaatggactttataat
ttaggtaatacatgttatatgaatgctgtaatacaatgcattgcacataccaaacaattt
ttagaatattcattacaatatcaattaaaagtttatataaatgaaaataacacaaaatgt
tcattaatagaaaatgttaccgaatctttaataaaaacaattcaaacattatacactcgt
aaagaatcaatttatcctcaatatttttttactacatttggtatttataaccaacaattt
tctgataaaaaacaaaaagatgctgcagaatttttgttattattacttgatgttatggac
aatgatcttcgaggtacaagtattattcaaccaccacctataatacataatgaagtttat
tataaagattatattgaatatattaaaaataataaatcaattattactcaaatgacaact
ggaatagttgtaagtaatttttgttgtgaaatttgtggaatatcttcaactcattctgaa
ccattttcattgttacaattaccaattattaaaaatctttcattttttaaaaaagttaac
tttaaaaattattctgaattaaaagaattaaaatatataacaatttatgattgtttaatt
ggttatttatactcttttcaaacatgtgttaattgtaatcatacacaaattcataataaa
gaattcgttgtaacacctccaattcttattattcaaattcttcgatttgaacaacattca
aataacacacaaaaagatcaaactacaattcttttccctttaaatgattttgttattgga
gtaacaaaatatcaattatatgcaactattgatcatacaggttcaattaatcatggtcat
tttactgctaattgtaaaataaataatttatggtatcattttgacgatgaaacagtaaaa
cctcttaataagatagatattgtttcaaaaaagtcatatatattgttttatgaaagaatt
taa

DBGET integrated database retrieval system