KEGG   Entamoeba histolytica: EHI_138020Help
Entry
EHI_138020        CDS       T00238                                 

Gene name
20.t00015
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ehi  Entamoeba histolytica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EHI_138020 (20.t00015)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EHI_138020 (20.t00015)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 315 aa AA seqDB search
MEFVEYTRSNKYKMKRVVVVGSSNTDLIGYCERYPQPGETILGKEFHTGFGGKGANQCIM
ASKFNDVEVSMVGFLGHDQFGNSTLQNYKDNGVNTSQIHFCNLPTGVAMITVDKTAQNQI
IVIPGANEALTPQFISTNANDIFKKGDIVVCQNEIPLETTYETLKQAKQHDCLTLWNPAP
APKEIDRNIIKYVDTLIVNTNESMQIGGESTPEESALKLHKEFGVLVIVTLGDKGCLIVG
EEQTKIDSVRVNAIDTTGAGDAFVGSYARCWAIGLDPKRSAEISVRIASDSVTRHGTQSS
YPNKEQIQKIISELN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgtagaatatactagatctaataaatataaaatgaaaagagtggttgttgtt
ggttcttcaaatactgatcttattggatattgtgaacgttatcctcaacctggagaaact
attcttggtaaagaatttcacactgggtttgggggaaaaggagcaaaccaatgtattatg
gcatctaaatttaatgatgttgaagtctctatggttggtttcttaggtcatgatcaattt
ggtaattcaactttacaaaactataaagataatggagttaatactagtcagatccatttt
tgtaacttaccaactggtgtagcaatgattactgttgataaaacggcacaaaaccaaatt
attgttattccaggagcaaatgaagcacttactcctcaatttataagtaccaacgctaat
gacatttttaaaaaaggagatattgttgtttgtcaaaatgaaattcctcttgaaaccaca
tacgagacattaaaacaagctaaacaacatgattgtcttacattatggaatcctgctcca
gcaccaaaagagattgatcgtaatatcataaaatatgttgatacactaattgttaatacc
aatgagtcaatgcaaattggaggtgaaagtacacctgaagaatctgcacttaaattgcat
aaagaatttggagttcttgttattgttacattaggagataaaggttgtttaattgttgga
gaggaacaaactaaaattgattctgtccgtgttaatgccattgatacaactggagcaggt
gatgcgtttgttggaagttatgcacgttgttgggcaattggacttgatccaaaaaggtca
gcagagatttctgttagaatagcttcagattctgttacgagacatggtactcaatcatcg
tatccaaataaagaacaaatccagaaaattatttctgaattaaattaa

DBGET integrated database retrieval system