KEGG   Entamoeba histolytica: EHI_140500Help
Entry
EHI_140500        CDS       T00238                                 

Gene name
60.t00040
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHI_140500 (60.t00040)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   EHI_140500 (60.t00040)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 311 aa AA seqDB search
MENEKFNWNTIESDPGVFNEMVKNLGCDDIQFKEIFSFDDSATFERIKPIKGFILLFEYN
KQTINYIRNEYSFIETNEYPDIFFAEQVVQNACATQAILSTLMNIPNINLGPTLQQFKNQ
TLPLNPHERGLAIGNNEIIRKAHNDFAQPSEALENKISEKLKGVEGRAYHFISIIPYNGI
LLLLDGLSEGPIIIGGADENWPITGMKPFFEGLINAMQGSLEFTLLAVVQDQIKKYQELY
ENALAEKKEYQIELYKDIIDEEKKIKEQQHKENKRRKHDYMPLALNLILFLGKRHKLEQE
IEKQINEITKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaaaaatttaattggaatactattgaatctgaccctggagtatttaatgaa
atggtaaaaaatttaggatgtgatgatattcaatttaaagaaatattttcttttgatgat
tctgctacatttgaacgaatcaaaccaataaaaggatttattttattatttgaatataat
aaacaaacaataaattatataagaaatgaatatagctttattgaaacaaatgaatatcct
gatattttctttgctgaacaagttgttcaaaacgcttgtgctactcaagcaatattatct
acattaatgaatatcccaaatattaatctaggaccaactttacaacaatttaaaaatcaa
acactaccattaaatcctcatgaacgtgggttggctattggaaataatgaaataattaga
aaagcccataatgattttgctcagccatctgaagcacttgaaaataaaatatcagaaaaa
ttaaaaggagtggaaggacgtgcatatcactttattagtattattccatataatggtatt
ttattattacttgatggacttagtgaaggaccaattattattggaggtgctgatgagaat
tggcctattacaggaatgaaaccattttttgaaggacttattaatgctatgcaaggaagt
cttgaatttactttattagcagtggttcaagaccaaattaagaaatatcaagaattatat
gaaaatgctcttgctgagaaaaaagaatatcaaatagaattgtataaagatattattgat
gaagaaaaaaaaattaaagaacaacaacacaaagaaaataaaagaagaaaacatgactat
atgccattagcattaaatttaattctatttcttggaaaacgtcataaattagaacaagaa
atagaaaaacaaataaatgaaataacaaagaagtaa

DBGET integrated database retrieval system