KEGG   Entamoeba histolytica: EHI_140660Help
Entry
EHI_140660        CDS       T00238                                 

Gene name
60.t00011
Definition
acetyltransferase, GNAT family
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHI_140660 (60.t00011)
Transcription machinery [BR:ehi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EHI_140660 (60.t00011)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MSEVKSMSDAPKVRGAIPREKEKKGEIKFITVANRGTREQLELLTAMKNIVSRHLPNMAL
DYISRIVYDTVYHESLLLINCKDNKPFGGICFRPFPTQGFVEIVFCAVDSTQQVQGFGSY
LMQHLKKEIQSRGIYHILTYADNQAIGYFMKQGFHKHVTLNKERWQGYIKDYVEATLMEC
VLHKNVEDYTDVPSTIKKQRDALQSLIGQVSKSEVRPGLTCFKQGIPKIKIEEIPGLKET
GWKPDVH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagtcaaaagtatgtctgatgcaccaaaagttcgaggagcaattccaagggaa
aaagaaaaaaaaggggaaattaaattcattactgtggctaatagaggaacaagagaacaa
ttagaattattaacagctatgaaaaatattgtttcaagacatttacctaatatggcattg
gattatattagtagaattgtttatgacactgtgtatcatgagtcattattgcttattaat
tgtaaagataataagccttttggtggaatttgttttagaccatttccaactcaaggattt
gttgaaatagttttttgtgctgttgattctacacaacaggtacaagggtttggttcatat
ctcatgcaacatttaaagaaagaaattcaaagtcgaggaatttatcatattttaacttat
gctgataatcaagctataggttattttatgaaacaaggatttcataaacatgtaacatta
aataaagaacgttggcaaggttacattaaagattatgtagaagccacattaatggaatgt
gtccttcacaagaatgtagaagactatactgacgttccttcaacaatcaaaaaacagcga
gatgcattacaatctctaataggacaagtgtctaaatctgaagtacgtccaggactaaca
tgttttaaacaagggattcctaagataaaaattgaagaaatacctggattgaaagaaact
ggttggaaacctgatgttcattaa

DBGET integrated database retrieval system