KEGG   Entamoeba histolytica: EHI_141870Help
Entry
EHI_141870        CDS       T00238                                 

Gene name
48.t00021
Definition
protein kinase domain containing protein
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EHI_141870 (48.t00021)
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   EHI_141870 (48.t00021)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MSCISQVQKPLTLLLTHEIQNTYLCCKEQKKNTQNKAKTRIDKDGHLLWRINEVLANRYQ
LIKGLGKGSFGQVIQSIDLVTGEQVALKVIRKDKNFYEQAKLEVQILYLLNSRDQTNNSK
IVRLKDTFNLSGHFCMVFELLSYNLYDFLMKKNGSLGLSLVRRFAFQILSALHFLQQPDI
RVIHCDLKPENIVLVSPNKADIKIIDFGSSCTPSTHMYKYIQSRYYRSPEVVMGLPYSHP
IDMWSLGCILPELLTTEPLFPARSEVELLVMMGALLGMPPNSMIKESHRARKLFIPHEND
ENYDFHPTLQPLYNKKKKLRNIIGVDIGGPLTRTPGERMERDELEKFCDLCLRMLSFDPN
KRITPREALAHPFFQSGIIKEINPLFKREEQKMEEEPLVNVETVNDSSRPMSR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtatttcacaagtacaaaaacctctaacattactacttactcatgaaattcaa
aatacatatttatgttgcaaagaacaaaagaaaaatacacaaaataaagctaaaacaaga
atagataaagatggacatttactttggagaattaatgaagtattagcaaatagataccaa
ttaataaaaggacttggaaaaggatcatttggacaagtaattcaatcgattgatttagta
acaggagaacaagttgctttaaaagtaataagaaaagataaaaatttttatgaacaagcg
aaattagaagttcaaatattatatttattaaattctcgtgatcaaacaaacaactctaaa
attgttcgtttaaaagatacattcaatttaagtggacatttttgtatggtatttgaatta
ctttcatacaatttatatgattttttaatgaaaaagaatggctcattagggctatcatta
gtaagaagatttgcatttcaaatattaagtgcattacattttttacaacaacctgatatt
agagtaattcattgtgacttaaaacctgaaaatattgttttagtatcaccaaataaagct
gatattaaaattattgattttggttcttcatgtacaccatctactcatatgtacaaatat
atccaatctagatattatcgttcacctgaagtagttatgggattaccttattctcatcca
atagatatgtggtctttaggttgtattttaccagaattacttacaactgaaccattattt
cctgctcgttctgaagttgaattacttgtaatgatgggagcattacttggaatgcctcct
aattcaatgataaaagaaagtcatcgtgcaagaaaattatttattcctcatgaaaatgat
gaaaattatgattttcatccaactcttcaacctctttataataagaaaaagaaattacga
aacattattggtgttgatattggtggacctttaacaagaactccaggtgaacgaatggaa
agagatgaacttgaaaagttctgtgatttatgtcttagaatgctttcttttgatcctaat
aaaagaatcactcctagagaagctcttgctcatccattctttcaaagtggtattattaaa
gaaatcaatcctttatttaagagagaagaacagaaaatggaggaagagccacttgttaat
gttgaaactgtgaatgatagtagtaggccaatgtcaagataa

DBGET integrated database retrieval system