KEGG   Entamoeba histolytica: EHI_142000Help
Entry
EHI_142000        CDS       T00238                                 

Gene name
48.t00008
Definition
histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 414 aa AA seqDB search
MSNILRFKINEKVLCHKHEDPEGSYREARILETREHNGNTEYYVRYTEYNKRLDEWTAAN
NIIRYSSKENIIRPTTKEDGVSQRKMTRALRQSNVSMLEKDSEVIDKTTPQENEIFQRTK
NIQHVTIGDYDLNVWYFSPYPGEYGHAERLYICEHCLKYMSKANTYIKHREHCPYHFPPG
LLIYKDDERHLAFFEVDGAEAKMFCQSLCLLSKMFLDHKTLYYDVEPFYFYVLCEFNYNE
QWKSDDYHIVGYFSKEKASPDGYNLSCLMVLPHHQRKGYGKMLISMSYELSKIEGIPGSP
EKPLSDLGLVSFKSYWSGVIAEELLNSTEIPSIEDLTLKTGITKEDCVSALDTLNCISPY
RGSQIISINHIKMEALREKCSKKVVLVKKELLHWKPHSVVVKYPNVMQTLKTYC
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatcttgagatttaagataaatgaaaaggtattgtgtcataaacatgaagat
cctgaaggatcatatagagaagcaagaattcttgaaacaagagaacataatggaaataca
gaatattatgttagatatacagaatataataaacgattagatgaatggacagcagcaaat
aatattatacgatattcatcaaaagaaaatattattagacctacaacaaaagaagatgga
gttagtcaacgtaaaatgacaagagcattacgtcaatcaaatgtttctatgttagaaaaa
gatagtgaagttattgataaaacaacaccacaagaaaatgaaatatttcaaagaacaaaa
aatattcaacatgttactattggagattatgatttaaatgtttggtatttttcaccatat
cctggagaatatggacatgcagaaagattatatatttgtgaacattgtcttaaatatatg
tctaaagcaaatacttatattaaacatagagaacattgtccatatcattttccaccagga
ttattaatttataaagatgatgaaagacatttagcattttttgaagttgatggagcagaa
gcaaaaatgttttgtcaatcactttgtttattaagtaaaatgtttttagatcataaaaca
ttatattatgatgtagaaccattctatttctatgttctttgtgaatttaattataatgaa
cagtggaaaagtgatgattatcatattgttggttatttttcaaaagaaaaagctagtcct
gatgggtataatttaagttgtttaatggtattaccacatcatcaacgaaaaggatatggt
aaaatgcttatttcaatgagttatgaattaagtaaaattgaaggaattccaggaagtcct
gagaaaccattaagtgatttaggattagttagtttcaaaagttattggtcaggagtaatt
gcagaagaattattaaattcaactgaaattccctccattgaagatcttactttaaaaaca
ggaataacaaaagaggattgtgtaagtgctttagatactttaaattgtatttctccatat
cgaggatcacaaattatttcaattaatcacattaaaatggaggcattacgtgaaaagtgt
tcaaagaaagtggttttagtgaaaaaagaattacttcattggaaaccacattcagtagta
gtaaaatatcctaatgttatgcaaacacttaagacatattgttaa

DBGET integrated database retrieval system