KEGG   Entamoeba histolytica: EHI_148560Help
Entry
EHI_148560        CDS       T00238                                 

Gene name
1.t00098
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ehi  Entamoeba histolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EHI_148560 (1.t00098)
Enzymes [BR:ehi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EHI_148560 (1.t00098)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 898 aa AA seqDB search
MVFITIHYSTPFGQAVCLEVSGEKKVYKLNYVDNNTWSGEVKFKSTGLINYRYLITKEDD
LTEIFRTEGSKESYPHSLDLTNLKSFDKVEVNDIFISGFDAEDTFLTTSYFRKVIYGKRP
QEKLEIKKLGKTTLLLKVRCTCVPEGQCVFVGGAIESLGKWDVSKAIKMTPTHVPYYEAL
IDISNETTSFEYKCFIADANSRANARWEDRSNRVYYIAPVAEEETEEKTKPVDTLIVKED
NDFSGLYYRGAAVVTPVFSLRTKASCGCGEFLDLKKVVDWCNITGLSLIQTLPVNDTTVY
FTWRDSYPYNPNSVQALHPMYLRLSSLTQDPEILAEINSVAQKLNALEQIDYEAVLKEKE
TITRKIFSKVGTTQKGFDEFKKSAGKWLIPYCVYRALIKSVDTPLPPTPKDFAEVEAMYA
ANKAECDYYAFVQYNLHLQLKEASDYAADHKVALKGDLPIGVSKRSVECWMYPNLFHLDK
STGAPPDYFSAGEGQNWGFPTYNWDNMAKDDYAWWKGRLSQMSQYFNAYRIDHILGFFRI
WAIPAIHRTGLLGRFSPDLPFSRQELEGYGIYDTDRLSYPYIRDHTLDSLFGDEKNFVIS
KFLVNNYNGTYNLKPEFQSEGAILEKTGLSPQFRESDKKIVNGLKLLLQNVCLIRDEQNP
NLFVPRIDMEKTYSSFNELDHWVQEGLKRLYNDYFYKRHEGLWEATARKRLPAMARASNM
LVCGEDLGMVPDCVVRVMNDMKINCLRIQRLTDTPNTLFYHPADYQYLTVSAPSGHDMST
IRGWWEEDRYKTQYFWEHLLGRSGAAPFTCPVDAVKTIFDMHLYGPAMLACFPLQDILSL
KLKYIEGRDPKLEQINDPSNPIHYWRYRCHVDMDEIIADNDLNNELRTAVEKSGRHLF
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggtctttattaccattcattacagtacaccatttggacaagcagtttgccttgaagtt
tcaggagaaaagaaggtatataaattaaattatgttgataataatacatggtctggagaa
gttaaatttaagtcaactggtcttattaactatcgttatctcattacaaaagaagatgat
ttaacagaaatctttagaactgaaggatcaaaagaatcatatccacattctcttgattta
actaatttgaaaagctttgataaagtagaagttaatgatatctttatttcaggatttgat
gctgaagatactttcttaactacttcttatttcagaaaagttatttatggtaaaagacca
caagaaaaacttgaaattaagaaattaggtaaaactactcttcttcttaaagttagatgt
acttgtgtcccagaaggtcaatgtgtatttgttggtggtgctattgaatctcttggtaaa
tgggatgtttctaaagctatcaaaatgacaccaactcatgttccatattatgaagctctt
atcgatatttctaatgaaactacttcttttgaatataagtgtttcattgctgatgctaat
tcacgtgctaatgctagatgggaagatagatctaatagagtttattatattgcaccagtt
gctgaagaagaaactgaagaaaaaactaaacctgttgacactcttattgtaaaagaagac
aacgactttagtggactttattatagaggagctgctgttgttactcctgtattttcactt
agaactaaagcatcttgtggatgtggtgaattccttgatttgaaaaaagttgttgattgg
tgtaatattactggattgtcattaattcaaactcttccagttaatgatactactgtatat
ttcacatggagagattcatatccatataatccaaattcagtacaagcccttcatccaatg
tatttgagactcagttcattaacccaagacccagaaattcttgctgaaattaattcagtt
gcacaaaaacttaatgccttagaacaaattgactatgaagctgttcttaaagaaaaagaa
acaattacaagaaaaatattctcaaaggttggaactactcaaaaaggatttgatgaattt
aaaaagagtgctggtaagtggttaatcccatattgtgtttatcgtgctcttattaaatca
gttgatacaccattaccaccaacaccaaaagattttgctgaggttgaagctatgtatgct
gctaataaagcagaatgtgattactatgcttttgtccaatataatcttcatttacaactt
aaagaagccagtgactatgctgctgatcataaggttgcattaaaaggagatcttccaatt
ggagtttcaaaaagatcagttgaatgttggatgtatccaaatcttttccatcttgataaa
tcaactggagcaccacctgattacttctcagctggtgagggacaaaactggggattccca
acatacaattgggataatatggcaaaggatgattatgcttggtggaaaggaagattatct
caaatgtcacagtatttcaatgcatatagaattgatcatattcttggattcttcagaatt
tgggctattcctgctattcatagaactggtcttcttggtagattttctccagacttacct
ttctctagacaagaacttgagggatatggtatttatgatactgataggttaagttatcca
tacattagagatcataccttagatagtctctttggtgatgaaaagaattttgtcatttct
aaattccttgttaataattataatggaacttataacttaaaaccagaattccaaagtgaa
ggtgctatccttgaaaagacaggactttctccacaatttagagaatcagataaaaaaatt
gttaatggacttaaacttcttttacaaaatgtatgtttgattagagatgaacaaaatcca
aatttgtttgttccaagaattgatatggaaaaaacatattctagctttaatgaacttgac
cattgggtacaagaaggtcttaagagattatataatgattacttctataagagacatgaa
ggtctttgggaagctactgctagaaagagacttccagctatggctagagcttctaatatg
cttgtctgtggtgaagatcttggaatggttccagattgtgttgttagagtaatgaatgat
atgaaaattaattgtttgagaattcaaagactcactgatactccaaatactcttttctat
catccagctgattatcaatatttgactgtttcagcaccatctggacatgatatgtcaact
atccgtggatggtgggaggaagatagatataagactcaatatttctgggaacatcttctt
ggaagatctggagctgcaccatttacttgtcctgttgatgctgttaaaactatctttgat
atgcatttgtatggaccagctatgcttgcatgtttcccacttcaagacattctttcactt
aaacttaagtacattgaaggacgtgatccaaaattagaacaaattaatgacccatctaat
ccaatccattattggagatatagatgccatgttgacatggatgaaattattgctgataat
gatttgaacaatgaacttagaactgccgttgaaaaatcaggcagacatcttttctaa

DBGET integrated database retrieval system