KEGG   Entamoeba histolytica: EHI_150490Help
Entry
EHI_150490        CDS       T00238                                 

Gene name
124.t00001
Definition
alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Amoebiasis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EHI_150490 (124.t00001)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_150490 (124.t00001)
   00620 Pyruvate metabolism
    EHI_150490 (124.t00001)
   00650 Butanoate metabolism
    EHI_150490 (124.t00001)
  Lipid metabolism
   00071 Fatty acid degradation
    EHI_150490 (124.t00001)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EHI_150490 (124.t00001)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EHI_150490 (124.t00001)
Enzymes [BR:ehi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EHI_150490 (124.t00001)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EHI_150490 (124.t00001)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 870 aa AA seqDB search
MSTQQTMTVDEHINQLVAKAQVALKEYLKPEYTQEKIDYIVKKASVAALDQHCALAAAAV
EETGRGIFEDKATKNIFACEHVTHEMRHAKTVGIINVDPLYGITEIAEPVGVVCGVTPVT
NPTSTAIFKSLISIKTRNPIVFSFHPSALKCSIMAAKIVRDAAIAAGAPENCIQWIEFGG
IEASNKLMNHPGVATILATGGNAMVKAAYSSGKPALGVGAGNVPTYIEKTCNIKQAANDV
VMSKSFDNGMICASEQAAIIDKEIYDQVVEEMKTLGAYFINEEEKAKLEKFMFGVNAYSA
DVNNARLNPKCPGMSPQWFAEQVGIKVPEDCNIICAVCKEVGPNEPLTREKLSPVLAILK
AENTQDGIDKAEAMVEFNGRGHSAAIHSNDKAVVEKYALTMKACRILHNTPSSQGGIGSI
YNYIWPSFTLGCGSYGGNSVSANVTYHNLLNIKRLADRRNNLQWFRVPPKIFFEPHSIRY
LAELKELSKIFIVSDRMMYKLGYVDRVMDVLKRRSNEVEIEIFIDVEPDPSIQTVQKGLA
VMNTFGPDNIIAIGGGSAMDAAKIMWLLYEHPEADFFAMKQKFIDLRKRAFKFPTMGKKA
RLICIPTTSGTGSEVTPFAVISDHETGKKYPLADYSLTPSVAIVDPMFTMSLPKRAIADT
GLDVLVHATEAYVSVMANEYTDGLAREAVKLVFENLLKSYNGDLEAREKMHNAATIAGMA
FASAFLGMDHSMAHKVGAAFHLPHGRCVAVLLPHVIRYNGQKPRKLAMWPKYNFYKADQR
YMELAQMVGLKCNTPAEGVEAFAKACEELMKATETITGFKQANIDEAAWMSKVPEMALLA
FEDQCSPANPRVPMVKDMEKILKAAYYPIA
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaacaaactatgactgtagatgaacatattaatcaacttgttgctaaagca
caagttgcacttaaagaatatcttaaaccagaatatacacaagaaaaaatagattatatt
gtaaagaaagcatcagttgcagcacttgatcaacattgtgcacttgcagcagctgcagtt
gaagaaacaggaagaggtatttttgaagataaagctactaaaaatatatttgcatgtgaa
catgttacacatgaaatgagacatgctaaaacagttggtattattaatgtagatccactt
tatggaattacagaaattgcagaaccagttggagttgtttgtggagttacaccagttact
aatccaacatcaacagctattttcaagtcacttatttcaattaaaacaagaaatccaatt
gtattttcattccatccatcagcacttaaatgttctattatggcagctaaaattgttaga
gatgcagctattgcagcaggagcaccagaaaattgtattcaatggattgaatttggagga
attgaagcatcaaataaattaatgaatcatccaggagttgctactattcttgctacagga
ggaaatgctatggttaaagcagcatattcatcaggaaaaccagcacttggagtaggagca
ggaaatgtaccaacatatattgaaaaaacatgtaatattaaacaagcagcaaatgatgta
gttatgtcaaaatcatttgataatggtatgatttgtgcatcagaacaagcagcaattatt
gataaagaaatttatgatcaagtagttgaagaaatgaaaacacttggagcatatttcatt
aatgaagaagaaaaagctaaattagaaaagtttatgtttggagttaatgcatattcagca
gatgttaataatgcaagacttaatccaaaatgtccaggtatgtcaccacaatggtttgct
gaacaagttggaattaaagttccagaagattgtaatattatttgtgcagtttgtaaagaa
gttggaccaaatgaaccattaacaagagaaaaattatcaccagttcttgctattcttaaa
gcagaaaatacacaagatggtattgataaagctgaagctatggttgaatttaatggtaga
ggacattcagcagctattcattcgaatgataaagcagtagttgaaaagtatgcacttaca
atgaaagcatgcagaattttacataatacaccatcatcacaaggaggaattggatcaatt
tataactatatttggccatcatttacacttggatgtggatcatatggaggaaattctgta
tcagctaatgttacatatcataatttattaaatattaaaagacttgcagatagaagaaac
aaccttcaatggttcagagttccaccaaagattttctttgaaccacattctattagatat
cttgctgaacttaaggaacttagtaaaatattcattgtttcagatagaatgatgtataaa
ttaggatatgtagatagagttatggatgtattgaaaagaagaagtaatgaagtagaaatt
gaaattttcattgatgtagaaccagatccatctattcaaaccgttcaaaaaggacttgct
gttatgaatacatttggaccagataatattattgctattggaggaggatcagctatggat
gcagctaagattatgtggttactttatgaacatccagaagccgatttctttgcaatgaaa
caaaaattcattgatcttagaaagagagcatttaaattcccaacaatgggtaagaaagct
agattaatttgtattccaacaacatcaggaactggatcagaagttacaccatttgcagtt
atttcagatcatgaaacaggtaagaaatatccacttgctgattattcacttacaccatca
gttgctattgttgatccaatgtttactatgtcacttccaaagagagctattgctgatact
ggacttgatgtattggttcatgcaacagaagcatatgtttcagttatggctaatgaatat
actgatggacttgctagagaagcagttaaattagtctttgaaaatcttcttaaatcatat
aatggagatttagaagcaagagaaaagatgcacaatgctgcaacaattgcaggtatggca
tttgcatcagcattccttggtatggaccattccatggcacataaagttggagcagcattc
catcttccacatggtagatgtgtagcagtattattaccacatgtcattagatataatgga
caaaaaccaagaaagcttgcaatgtggccaaaatataatttctataaggcagaccaaaga
tatatggaacttgcacaaatggttggacttaaatgtaatacaccagctgaaggagttgaa
gcatttgctaaagcatgtgaagaattaatgaaagccacagagactattactggattcaag
caagcaaatattgatgaagcagcatggatgagtaaagtaccagaaatggcacttcttgca
tttgaagatcaatgttcaccagctaatccaagagtcccaatggttaaggatatggaaaag
attctcaaagctgcatattatccaattgcttaa

DBGET integrated database retrieval system