KEGG   Entamoeba histolytica: EHI_152010Help
Entry
EHI_152010        CDS       T00238                                 

Gene name
2.t00070
Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHI_152010 (2.t00070)
Transfer RNA biogenesis [BR:ehi03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    EHI_152010 (2.t00070)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 576 aa AA seqDB search
MKSNVIRGRKGPAKYGRNSVQFVACINEIVQVMIDLYEKGEEINLNKLKSQMAQKHNLHT
APKQVDIIAAIPDSHRPFLLPIVKSKPVRTASGIVAIAVMCKPHRCPNIRTNGDSCVYCP
GGCDSDFEYSTQSYTGYEPTSMRAVRARYNPYIQSRSRVEQLQKLGHSVEKVEYIIMGGT
FLSMDKHYRDSFILGLFDALSGHVSSTVEEAVHYGENSKVKCVALTIETRPDCCSEDHIR
EMFRYGTTRLEIGLQSIFEDICKECNRGHTVQDCIGCYKRLKDAGYKIVTHMMPNLPGVP
PERDVFTYSEMFSDGAYQCDGLKLYPCLVIRGTRLYEMWRKGHYHSYTSEETIDVLSRIL
ALIPPWVRVHRIQRDIPIPLVSAGADKGNLREYVQRQMDANNWPCRDTRTREVGIAALQG
KPGKKVKCVKDIELIRRDYVGSDGWETFLSYEDPENDLLIGLLRLRLPTNEKFMPELKGK
TSIIRELHVYGTSIPVNTKNLNQFQHMGYGALLIQEAERIAREEHGSDKIVIISGVGVRH
YYRKFGYTLDGPYMAKSLNEDHPQLQDIRRFNDYEN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaacgttataagaggtcgtaaaggtcctgctaagtatggaagaaattctgtt
caatttgttgcatgtattaatgaaattgttcaagtaatgattgatttatatgaaaaaggt
gaagaaattaatttaaataaattaaagtctcaaatggctcaaaaacataatttacatact
gcacctaaacaagttgatattatcgctgctattcctgattctcatcgtccatttcttctt
cctattgttaaatcaaaacctgttcgtacggcttctggtattgttgctattgctgtaatg
tgtaaaccacatcgttgtccaaacattagaactaatggtgattcatgtgtttattgtcct
ggtggatgtgattctgattttgaatattctacacaatcttatactggttatgaaccaact
tctatgcgtgctgttcgtgcaagatacaatccatatattcaatcaagatcaagagtagaa
caacttcaaaaacttggtcatagcgttgaaaaagttgagtatattattatgggaggtaca
ttcctttctatggataaacattatagagactctttcattcttggattatttgatgcatta
tcaggacatgtttcatctactgttgaagaggcagtacattatggagaaaattctaaagta
aaatgtgttgctttaactattgaaacacggcctgattgttgttcagaggatcatataaga
gaaatgtttagatatggaacaacacgtttagaaattggattgcaatcaatttttgaagat
atttgcaaagaatgtaatagaggtcatactgttcaagattgtattgggtgttataagaga
ttaaaagatgcaggatataagattgttactcatatgatgccaaatcttccaggtgtacca
cctgaaagagatgtttttacatatagtgaaatgtttagtgatggggcatatcaatgtgat
ggattaaaactatatccatgtcttgttattcgtggaactcgtttatatgaaatgtggaga
aaaggacattaccattcatatacttctgaagaaactattgatgtcctttcacgtattctt
gcattaattccaccttgggtaagagtacatcgtattcaaagagatattccaattccatta
gtttcagctggtgctgataaaggtaatttaagagaatacgttcaacgtcaaatggatgct
aataattggccatgtagagatactagaactagagaagttggtatagctgctctacaaggt
aaaccaggaaagaaagtcaaatgtgtaaaagatatcgaattaataagaagagattatgtt
ggttctgatggatgggaaacattcttatcatatgaagacccagaaaatgatttattgatt
ggattattaagacttagacttccaactaatgaaaagtttatgccagaacttaaaggaaaa
acatccatcataagagaattacatgtctatggtacttctattccagttaatactaagaat
ttaaatcaattccaacacatgggttatggtgctttacttattcaagaggctgaacgaatt
gctagagaagaacatggaagtgataaaattgttattatttctggtgttggggtacgacat
tattatagaaaatttggttatactttagatggtccatacatggctaaatcattaaatgag
gatcatccacaactacaagatattagaagatttaatgattatgaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system