KEGG   Entamoeba histolytica: EHI_152330Help
Entry
EHI_152330        CDS       T00238                                 

Gene name
6.t00005
Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ehi  Entamoeba histolytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Amoebiasis
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EHI_152330 (6.t00005)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EHI_152330 (6.t00005)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EHI_152330 (6.t00005)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     EHI_152330 (6.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MQFEKVTYIAVPQKYGQKKVGVEEGPKFLEKLGFMNVLEQVAKSVNKKTITEPKTPQELG
VTNARNLNEVESVNIELRDTIAKEYDVNNLLINIGGDHSIGLGTIAGVVKAMKPNARVGV
VWFDAHPDMNTPENSPSGNIHGMPLACAVGLGPQRLTSIMPHYITPKDIMYVGIRSIDVG
EQFEIQDKHIDHFTAEDVKRVGMKEVIEAINKKFVDYDVIHLSFDIDGIDPEFILGTGTP
VPKGISLEDSLYFMSEMGKMKKLHSVDIVEYNPKIEEEITGKNVLKCISSLFGIKC
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgaaaaagttacatacattgctgttccacaaaaatatggtcaaaagaaagtt
ggagttgaagaaggacctaaatttctcgaaaaattaggttttatgaatgtcttagaacaa
gtagcaaaaagtgttaataaaaaaaccattacagaaccaaaaacaccacaagaattagga
gtaactaatgcaagaaatttaaatgaagttgagtctgtcaatattgagctaagagataca
attgcaaaagaatatgatgttaataatttacttattaatattggtggtgaccattctatt
ggacttggaactattgctggtgttgttaaagcaatgaaaccaaatgctagggttggtgtt
gtttggtttgatgctcatcctgatatgaacactccagaaaattcaccttctggaaatatc
catggaatgccattagcttgtgctgttggtcttggaccacaaagacttacttctattatg
ccacattatattactcctaaagatattatgtatgttggaattagaagtattgatgttgga
gaacaatttgaaattcaagataaacatattgaccacttcactgctgaagatgttaaaaga
gttggaatgaaagaagtcattgaagcaatcaataaaaagtttgtcgattatgatgtaatc
catttatcatttgacattgatggtattgacccagaattcattttgggaactggcactcca
gtaccgaaaggaatttctttagaagattctttatattttatgtctgaaatgggtaaaatg
aaaaaattacattctgttgatatagttgaatataatcctaaaattgaagaagaaattact
ggaaaaaatgttttgaaatgtatctcttcactttttggtataaagtgttga

DBGET integrated database retrieval system