KEGG   Entamoeba histolytica: EHI_152330Help
Entry
EHI_152330        CDS       T00238                                 

Gene name
6.t00005
Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ehi  Entamoeba histolytica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Amoebiasis
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ehi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ehi00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ehi05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 296 aa AA seqDB search
MQFEKVTYIAVPQKYGQKKVGVEEGPKFLEKLGFMNVLEQVAKSVNKKTITEPKTPQELG
VTNARNLNEVESVNIELRDTIAKEYDVNNLLINIGGDHSIGLGTIAGVVKAMKPNARVGV
VWFDAHPDMNTPENSPSGNIHGMPLACAVGLGPQRLTSIMPHYITPKDIMYVGIRSIDVG
EQFEIQDKHIDHFTAEDVKRVGMKEVIEAINKKFVDYDVIHLSFDIDGIDPEFILGTGTP
VPKGISLEDSLYFMSEMGKMKKLHSVDIVEYNPKIEEEITGKNVLKCISSLFGIKC
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgaaaaagttacatacattgctgttccacaaaaatatggtcaaaagaaagtt
ggagttgaagaaggacctaaatttctcgaaaaattaggttttatgaatgtcttagaacaa
gtagcaaaaagtgttaataaaaaaaccattacagaaccaaaaacaccacaagaattagga
gtaactaatgcaagaaatttaaatgaagttgagtctgtcaatattgagctaagagataca
attgcaaaagaatatgatgttaataatttacttattaatattggtggtgaccattctatt
ggacttggaactattgctggtgttgttaaagcaatgaaaccaaatgctagggttggtgtt
gtttggtttgatgctcatcctgatatgaacactccagaaaattcaccttctggaaatatc
catggaatgccattagcttgtgctgttggtcttggaccacaaagacttacttctattatg
ccacattatattactcctaaagatattatgtatgttggaattagaagtattgatgttgga
gaacaatttgaaattcaagataaacatattgaccacttcactgctgaagatgttaaaaga
gttggaatgaaagaagtcattgaagcaatcaataaaaagtttgtcgattatgatgtaatc
catttatcatttgacattgatggtattgacccagaattcattttgggaactggcactcca
gtaccgaaaggaatttctttagaagattctttatattttatgtctgaaatgggtaaaatg
aaaaaattacattctgttgatatagttgaatataatcctaaaattgaagaagaaattact
ggaaaaaatgttttgaaatgtatctcttcactttttggtataaagtgttga

DBGET integrated database retrieval system