KEGG   Entamoeba histolytica: EHI_152580Help
Entry
EHI_152580        CDS       T00238                                 

Gene name
6.t00072
Definition
Ras guanine nucleotide exchange factor
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 677 aa AA seqDB search
MSSEQIHMTSSSKQRSVLIGRRVDQNKSYNSLPGTPLQQISSPKKQISSLYSSTQITETS
TPIEEVKEVIKKDDKINKGLFCELPSGSPIEQKLQAVQLYEVNLDNSLKKLCKTNQLHFK
PTYTQQQKELMQQILDQYPKEMFINCYSFGDPGENSNELNGLKEILYKLEETIHTVNEKI
NPPFVLPYSKRQTIPDFVYKIGDTYNVQMEILTIKMRIRKAYYELYAMIKSAQMSTYKED
VECFNEKVSVLSESLKREKEKISNQKRSAFIKVSLQTDSKGIETDDKGEVVSGSIEALIR
WAVNPNIDNNIKFIETLLITYRQYLSPTEFFNKLIGLYNENKNESNNKQIKDVQHKTILK
ILFMLSKWMSSFPHDFMDGGKEALLPLLDQFIKQNENDTLLKKTALNKQMMIQSASQKLT
IEEKLDIVNVQQEYTISTLPTEQFAQQLTLYEYELFKSIEAKEMLGNAWTKSDKTERSPN
LCALIDHFNSITNWVISTIVDESNIKQRATIIKKFISIGEEMLRLNNYNGVFEMFSGLNS
TPVGRLKLTWEEVGNFSKKMKALERVTIPTGSYQAYRADIKSHQSFPCIPFFGVYLQDLT
FIHEGNEDKNENGDVNFVKCSLTTKVIEDMLFYKRYYEYYRNPEILAFIRKIEIRCLTMG
EKELYDKSLIIEPRQQN
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagaacaaattcatatgacaagttcctcaaaacaacgttcagtattaattgga
agaagggttgatcaaaataaatcatataactctcttccagggactccattacaacaaatc
tcatcacccaaaaagcaaatttcttcattatattcatcaacacaaataacagaaacatcc
actccaatagaagaagttaaagaagttataaaaaaagatgacaagataaataaaggatta
ttttgtgaattaccaagtggttctcctattgaacaaaaactccaagctgttcaattgtat
gaagtgaatttagataattcattaaagaaattatgtaaaacaaaccaactccattttaaa
ccaacatatacacaacaacaaaaagaattaatgcaacaaattcttgatcaatatcctaaa
gaaatgtttattaattgttattcatttggagatccaggagaaaattcaaatgaattaaat
ggattaaaagaaattttatataaattagaagaaacaattcatacagtaaatgaaaaaata
aatcctccttttgttcttccttatagcaaaagacaaacaattcctgattttgtttataaa
atcggagatacttataatgttcaaatggaaatccttactataaaaatgagaattagaaaa
gcttattatgaattatacgctatgattaaatcagcacaaatgtcaacttataaagaagat
gtagaatgttttaatgaaaaagttagtgttcttagtgaaagtctaaaaagagaaaaagaa
aaaatttcaaatcaaaaacgttctgcttttattaaagttagtcttcaaacagattctaaa
ggtattgaaactgacgataaaggagaagttgtttctggatctattgaagcattaataaga
tgggcagttaatccaaatattgataataatatcaaatttatagaaacattacttattact
tatagacaatacctttctccaacagaattttttaataaattaattgggttatacaatgaa
aataaaaatgaatcaaataataaacaaattaaagatgtacaacataaaactattcttaaa
attctttttatgctatctaaatggatgtcttcatttcctcatgattttatggatggtggt
aaagaggcgttattacctcttttagatcaatttattaaacaaaatgaaaatgatacattg
ttgaagaaaactgcactaaataaacaaatgatgattcaaagtgcttctcaaaaattaact
attgaagaaaaacttgatatagttaatgttcaacaagaatatactatttctactttacca
actgaacaatttgcacaacaactaactttatatgaatatgaattatttaaatctattgaa
gcaaaagaaatgttgggaaatgcttggactaaaagcgataaaactgaacgaagtccaaat
ctttgtgcattgatagaccattttaattcaattacaaattgggttatctctactattgtt
gatgagtcaaatataaaacaacgtgcaacaattatcaaaaaattcatttctatcggagag
gagatgcttcgattaaataattacaacggagttttcgaaatgttttctggattgaactca
actcctgttggtagattaaaattgacctgggaagaagttggtaatttttcaaaaaagatg
aaagcactagagagagtaactattccaacaggaagttatcaggcataccgtgctgatatt
aaatcacatcaatcattcccttgtattccattttttggagtctatcttcaggatttaact
tttattcatgaaggtaatgaagataaaaatgaaaatggtgatgttaattttgtaaaatgt
tcattaacaacaaaggtgattgaagatatgttattttataaaagatattatgaatattac
cgtaatcctgaaatacttgcttttattaggaagattgagattagatgtttgacaatgggt
gaaaaggaactttacgacaaatcactaattattgaaccacgtcaacaaaattga

DBGET integrated database retrieval system