KEGG   Entamoeba histolytica: EHI_158590Help
Entry
EHI_158590        CDS       T00238                                 

Gene name
277.t00007
Definition
protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EHI_158590 (277.t00007)
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   EHI_158590 (277.t00007)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 675 aa AA seqDB search
MSTTTHHHRKRFIKSDYRMNYLCSQDSFFTPFTKENRSMSPGNDFESSVRQATITYIDVL
KRCNPNLDFSSVITKRALTSPSTPAHNDYHDNCKYDYILYTDEVIGTGVPGVVSYGKKQG
TRYRVLCLLGQGAFGQVVKCFDEVNKTFVAIKVLKNRPAYYRQAMLEIAVLQVLNEKFDV
DGRGHTLRLLDHFVFHNHVCIVTELLSINLYELMKQNNCRALFVQLARSILQQLLEALVI
LFRNGIIHCDLKPENVLLIDVSRNIKLIDFGSACFENSTLYSYIQSRHYRSPEVILGLPY
SSAIDMWSFGCMAAELFVGIPIFPGNSEYNMLFKFINMLGMPPRNLLDKGSKTSKFFRRK
RPSEMKNKDDVWAFKSKREFEEDNNIYTEPNREYFTYKTLEDIAMKVAFRVSSADEPHKL
EMRVAFLDFLKRALQWDPEVRMRPDQALQHPFITKTPLPSNYTLPPTTEPLRSFPPGTQL
TTEEVLQKIAPNPAAAQKLRTMGYNATTYYQVYADGLSKGIVLNILNSNPFFLQPMTPPA
LIRINQQEEEKKRRLLEENKGNILYQGIGSSTIQQEVMKNRSLFKEHSKKEEHKKQRRQT
GDVFSNKGMETLSPRAEDFLVAQSMKIDQQQATSYAGSNITLPGSTSDGSMAGSWSTQAG
MLLPGGTTGSINPYD
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaacaacccaccatcatagaaaaagatttattaaatctgattatcgtatgaat
tacctttgttcacaagatagtttctttactccatttactaaagaaaatcgttcaatgtca
ccagggaatgattttgaatcttcagtacgacaagcgactattacttatattgatgtacta
aaaagatgtaatccaaacctcgatttttcttctgttattacaaagagagcattaacatca
ccatcaacaccagcacataatgactatcatgataattgtaaatatgattatattctttat
acagatgaggttattggaactggagttccaggagtagtttcatatggaaaaaaacaagga
acaagatatagagttctttgtttattaggacaaggagcatttggacaagttgtaaaatgt
tttgatgaagtaaataaaacatttgtagcaattaaagtattaaagaatagaccagcttat
tatagacaagccatgttagaaatagcagtattacaagtattaaatgaaaaatttgatgtt
gatggacgtggacatactcttcgtcttttagaccattttgtatttcataatcatgtttgt
attgtaacagaattattatcaattaatttatatgaattaatgaaacaaaataattgtcgt
gccttatttgttcaattagcacgatcaattcttcaacaattattagaagcacttgttata
ttatttagaaatggaattattcattgtgatcttaaaccagaaaatgtattattaattgat
gtatcaaggaacattaaattaatagattttggttcagcatgttttgaaaatagtacgtta
tattcttatattcaatcaagacattatagatcaccagaagttatattaggattaccttat
tctagtgcaattgatatgtggtcatttggatgtatggcagcagaattatttgttggaata
ccaatatttccaggaaacagtgaatataatatgttatttaaatttattaatatgttagga
atgcctccaagaaatttattagataaaggaagtaaaacttctaaattttttagaagaaaa
agaccatcagaaatgaaaaataaagatgatgtttgggcatttaaaagtaaaagagaattt
gaagaagataataatatttatactgaacctaatagagaatattttacatataaaacatta
gaagatattgctatgaaagttgcttttagagtttcttctgctgatgagcctcataaactg
gaaatgagagttgcatttttagattttcttaaacgtgcacttcaatgggatcctgaagtt
agaatgagaccagatcaagctttacaacatccttttattactaaaactccattaccaagt
aattatactcttccacctactacagaaccattaagatcattccctccaggaactcaactt
actactgaagaagtattacaaaaaattgcaccaaatccagctgcagcacaaaagttacga
actatgggatataatgctacaacatattatcaagtttatgctgatggattaagtaaagga
attgtattaaatatccttaattctaatccattctttttacaaccaatgacaccacctgca
ttaattcgtataaatcaacaagaagaagaaaagaaaagaagattattagaagaaaataaa
ggaaatattttatatcaaggaattggttcatctacaattcaacaagaagttatgaagaat
aggtctttgtttaaagaacattcgaaaaaagaagaacataagaaacaaagaagacaaact
ggtgatgtcttctcaaataaaggaatggaaactttatcacctcgtgctgaagacttttta
gtagcacaaagtatgaaaattgatcaacaacaagctacttcatatgctggtagtaatatt
actttaccaggttctacatcagatggatcaatggcaggttcttggagtacacaagcaggc
atgttgcttccaggaggaactactggaagtataaatccatatgattaa

DBGET integrated database retrieval system