KEGG   Entamoeba histolytica: EHI_159690Help
Entry
EHI_159690        CDS       T00238                                 

Gene name
233.t00007
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ehi  Entamoeba histolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHI_159690 (233.t00007)
Translation factors [BR:ehi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    EHI_159690 (233.t00007)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 171 aa AA seqDB search
MEHKLFSEWTFWFDGFSNKSTETYGSNIVPIGSFKTAEEFWGIYDAIPKLGTMENGSDVS
LFKNGIKPIWEDTSNVGGGRIQIILTNANNELCQQYWRDTLLSLIGETIPSAYCINGVAF
SVRQHNKIALWLDKSGKEHLNEISKKLRDIIPSEGTIIYYSHDPSVEPIVC
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaattattcagtgaatggactttttggtttgatggattttcaaataaatca
actgaaacatatggttcaaacattgtccctattggaagctttaaaactgctgaagaattt
tggggaatatatgatgctattcctaaattaggcacaatggaaaatggatcagatgtttca
ttattcaaaaatggaattaaaccaatatgggaagacactagtaatgttggaggtggaaga
atacaaataattttgactaatgctaataatgagttatgtcaacaatactggagagatact
ttattaagtttaattggtgaaactattccatctgcttattgtatcaatggtgttgcattt
tctgttcgtcaacacaataaaattgcgttatggcttgacaaatcaggaaaagaacattta
aatgaaatatcaaaaaaattaagagacattattcctagtgaagggacaatcatatattac
agtcatgacccttctgtagagcctattgtgtgttaa

DBGET integrated database retrieval system