KEGG   Entamoeba histolytica: EHI_159690Help
Entry
EHI_159690        CDS       T00238                                 

Gene name
233.t00007
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ehi  Entamoeba histolytica
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ehi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 171 aa AA seqDB search
MEHKLFSEWTFWFDGFSNKSTETYGSNIVPIGSFKTAEEFWGIYDAIPKLGTMENGSDVS
LFKNGIKPIWEDTSNVGGGRIQIILTNANNELCQQYWRDTLLSLIGETIPSAYCINGVAF
SVRQHNKIALWLDKSGKEHLNEISKKLRDIIPSEGTIIYYSHDPSVEPIVC
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaattattcagtgaatggactttttggtttgatggattttcaaataaatca
actgaaacatatggttcaaacattgtccctattggaagctttaaaactgctgaagaattt
tggggaatatatgatgctattcctaaattaggcacaatggaaaatggatcagatgtttca
ttattcaaaaatggaattaaaccaatatgggaagacactagtaatgttggaggtggaaga
atacaaataattttgactaatgctaataatgagttatgtcaacaatactggagagatact
ttattaagtttaattggtgaaactattccatctgcttattgtatcaatggtgttgcattt
tctgttcgtcaacacaataaaattgcgttatggcttgacaaatcaggaaaagaacattta
aatgaaatatcaaaaaaattaagagacattattcctagtgaagggacaatcatatattac
agtcatgacccttctgtagagcctattgtgtgttaa

DBGET integrated database retrieval system