KEGG   Entamoeba histolytica: EHI_159690Help
Entry
EHI_159690        CDS       T00238                                 

Gene name
233.t00007
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
ehi  Entamoeba histolytica
Pathway
ehi03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHI_159690 (233.t00007)
Messenger RNA biogenesis [BR:ehi03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     EHI_159690 (233.t00007)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     EHI_159690 (233.t00007)
Translation factors [BR:ehi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    EHI_159690 (233.t00007)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 3404547
NCBI-ProteinID: XP_650247
UniProt: C4LX49
AA seq 171 aa AA seqDB search
MEHKLFSEWTFWFDGFSNKSTETYGSNIVPIGSFKTAEEFWGIYDAIPKLGTMENGSDVS
LFKNGIKPIWEDTSNVGGGRIQIILTNANNELCQQYWRDTLLSLIGETIPSAYCINGVAF
SVRQHNKIALWLDKSGKEHLNEISKKLRDIIPSEGTIIYYSHDPSVEPIVC
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacataaattattcagtgaatggactttttggtttgatggattttcaaataaatca
actgaaacatatggttcaaacattgtccctattggaagctttaaaactgctgaagaattt
tggggaatatatgatgctattcctaaattaggcacaatggaaaatggatcagatgtttca
ttattcaaaaatggaattaaaccaatatgggaagacactagtaatgttggaggtggaaga
atacaaataattttgactaatgctaataatgagttatgtcaacaatactggagagatact
ttattaagtttaattggtgaaactattccatctgcttattgtatcaatggtgttgcattt
tctgttcgtcaacacaataaaattgcgttatggcttgacaaatcaggaaaagaacattta
aatgaaatatcaaaaaaattaagagacattattcctagtgaagggacaatcatatattac
agtcatgacccttctgtagagcctattgtgtgttaa

DBGET integrated database retrieval system