KEGG   Entamoeba histolytica: EHI_163630Help
Entry
EHI_163630        CDS       T00238                                 

Gene name
74.t00023
Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ehi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ehi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ehi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ehi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ehi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ehi00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MSERRHVHQRNDLLIAKKPEEPLPSLKITSLGECKYENTYASPEPFVDGMTMSMSAIKID
GIPVNECEAELAGPMEKIFFIPERTKVGIVTCGGLCPGLNNVIRGLVMNLQNRYGVKQIY
GLKYGYEGLVPELSEQMKLDTSVVDDIHQRGGTILGTSRGAQDPKIMAQFLIDNNFNILF
TLGGDGTLRGANAINKELRRRGSPIAVVGIPKTIDNDICYTDSTFGFDTAVELAQEAINS
VHCEAKSAKNGVGIVKLMGRDAGFIALYASVASGDVNLVLIPEVDTPIEEILKMTERRLM
SKGHIVIVIAEGACQNLKPKGLDLGSDKSGNIVHWDAVTYIRQEIDKYLENKKIEHTIKF
VDPSYMIRSAPCSAADAHFCLCLANAAVHVAMAGKTGLVICHHHNNFVSIPIERACYYLK
RVNPEGPMLSMMKSIESVE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagaagacatgtccatcaaagaaatgatttacttattgctaaaaaaccagaa
gaaccacttccatcattaaaaattacatcattaggagaatgtaaatatgaaaatacatat
gcatcacctgaaccttttgtagatggaatgacaatgtctatgtctgctattaaaattgat
ggaatacctgttaatgaatgtgaagctgagttagcaggaccaatggaaaaaatattcttc
attccagaaagaaccaaagttggaatagtaacatgtggaggattatgtccaggattaaat
aatgttattagaggattagttatgaaccttcaaaatagatatggagttaaacaaatttat
ggtttaaaatatggttatgaaggacttgttcctgaattatctgaacaaatgaaacttgac
acatctgttgtagatgatattcatcaaagaggtggaactatattaggtacttcaagagga
gctcaagaccctaaaattatggcacaatttcttattgacaataattttaatattctcttc
acattaggaggagatggtacattaagaggggcaaatgcaattaataaagaattaagaaga
agaggtagtcctattgcagttgttggtattcctaaaactattgacaatgacatttgttat
acagactctacttttgggtttgatactgctgtagaattagcacaagaagctattaattca
gttcattgtgaagctaaatcagcaaagaatggagttggaatagttaaactaatgggtaga
gatgcagggtttattgcattatatgcatcagttgcatcaggagatgtaaatttagtatta
attcctgaggttgatacaccaattgaagagattcttaaaatgacagaaagaagattaatg
tcaaaaggacatatagtgattgttattgctgaaggggcatgtcaaaatcttaaaccaaaa
ggtcttgatcttggtagtgataaatcaggaaatattgttcattgggatgctgttacatat
attagacaagaaatagataagtatttagaaaataaaaaaatagaacatactattaaattt
gttgatccatcttatatgattcgatcagcaccatgtagtgcagctgatgcacatttctgt
ttatgtttagcaaatgcagcagttcatgtagctatggcaggaaaaacaggattagttatt
tgtcatcatcataacaattttgtttcaataccaattgaaagggcatgttattatttgaaa
agagtgaaccctgaaggaccaatgttatcaatgatgaagtctattgagtctgttgaatga

DBGET integrated database retrieval system