KEGG   Entamoeba histolytica: EHI_163630Help
Entry
EHI_163630        CDS       T00238                                 

Gene name
74.t00023
Definition
(RefSeq) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00010  Glycolysis / Gluconeogenesis
ehi00030  Pentose phosphate pathway
ehi00051  Fructose and mannose metabolism
ehi00052  Galactose metabolism
ehi01100  Metabolic pathways
ehi01110  Biosynthesis of secondary metabolites
ehi01130  Biosynthesis of antibiotics
ehi01200  Carbon metabolism
ehi01230  Biosynthesis of amino acids
ehi03018  RNA degradation
Module
ehi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_163630 (74.t00023)
   00030 Pentose phosphate pathway
    EHI_163630 (74.t00023)
   00051 Fructose and mannose metabolism
    EHI_163630 (74.t00023)
   00052 Galactose metabolism
    EHI_163630 (74.t00023)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EHI_163630 (74.t00023)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EHI_163630 (74.t00023)
Protein phosphatases and associated proteins [BR:ehi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EHI_163630 (74.t00023)
Messenger RNA biogenesis [BR:ehi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EHI_163630 (74.t00023)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 3408021
NCBI-ProteinID: XP_653723
UniProt: C4M3U3
AA seq 439 aa AA seqDB search
MSERRHVHQRNDLLIAKKPEEPLPSLKITSLGECKYENTYASPEPFVDGMTMSMSAIKID
GIPVNECEAELAGPMEKIFFIPERTKVGIVTCGGLCPGLNNVIRGLVMNLQNRYGVKQIY
GLKYGYEGLVPELSEQMKLDTSVVDDIHQRGGTILGTSRGAQDPKIMAQFLIDNNFNILF
TLGGDGTLRGANAINKELRRRGSPIAVVGIPKTIDNDICYTDSTFGFDTAVELAQEAINS
VHCEAKSAKNGVGIVKLMGRDAGFIALYASVASGDVNLVLIPEVDTPIEEILKMTERRLM
SKGHIVIVIAEGACQNLKPKGLDLGSDKSGNIVHWDAVTYIRQEIDKYLENKKIEHTIKF
VDPSYMIRSAPCSAADAHFCLCLANAAVHVAMAGKTGLVICHHHNNFVSIPIERACYYLK
RVNPEGPMLSMMKSIESVE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagaagacatgtccatcaaagaaatgatttacttattgctaaaaaaccagaa
gaaccacttccatcattaaaaattacatcattaggagaatgtaaatatgaaaatacatat
gcatcacctgaaccttttgtagatggaatgacaatgtctatgtctgctattaaaattgat
ggaatacctgttaatgaatgtgaagctgagttagcaggaccaatggaaaaaatattcttc
attccagaaagaaccaaagttggaatagtaacatgtggaggattatgtccaggattaaat
aatgttattagaggattagttatgaaccttcaaaatagatatggagttaaacaaatttat
ggtttaaaatatggttatgaaggacttgttcctgaattatctgaacaaatgaaacttgac
acatctgttgtagatgatattcatcaaagaggtggaactatattaggtacttcaagagga
gctcaagaccctaaaattatggcacaatttcttattgacaataattttaatattctcttc
acattaggaggagatggtacattaagaggggcaaatgcaattaataaagaattaagaaga
agaggtagtcctattgcagttgttggtattcctaaaactattgacaatgacatttgttat
acagactctacttttgggtttgatactgctgtagaattagcacaagaagctattaattca
gttcattgtgaagctaaatcagcaaagaatggagttggaatagttaaactaatgggtaga
gatgcagggtttattgcattatatgcatcagttgcatcaggagatgtaaatttagtatta
attcctgaggttgatacaccaattgaagagattcttaaaatgacagaaagaagattaatg
tcaaaaggacatatagtgattgttattgctgaaggggcatgtcaaaatcttaaaccaaaa
ggtcttgatcttggtagtgataaatcaggaaatattgttcattgggatgctgttacatat
attagacaagaaatagataagtatttagaaaataaaaaaatagaacatactattaaattt
gttgatccatcttatatgattcgatcagcaccatgtagtgcagctgatgcacatttctgt
ttatgtttagcaaatgcagcagttcatgtagctatggcaggaaaaacaggattagttatt
tgtcatcatcataacaattttgtttcaataccaattgaaagggcatgttattatttgaaa
agagtgaaccctgaaggaccaatgttatcaatgatgaagtctattgagtctgttgaatga

DBGET integrated database retrieval system