KEGG   Entamoeba histolytica: EHI_164850Help
Entry
EHI_164850        CDS       T00238                                 

Gene name
34.t00011
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ehi  Entamoeba histolytica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    EHI_164850 (34.t00011)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     EHI_164850 (34.t00011)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EHI_164850 (34.t00011)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MKYILAIDQGTTSTRVILFDEKCQSIHTEQEEFDSIFPHPGWVEQDPEVIYTSVVNLMKK
CLVNTGINKEDIAAIGITNQRETTVMWDKRTGKPIYNAIVWQSKQSGNETSYLMEKGYEE
IFQSKTGLVLNPYFSASKIMWIFNNVEGAKALAEEGVLLFGTIDTWIIYNLTGGQSHSTD
ISNAARTLLFNIYEKKWDDELLAKTNIPKSILPIVKQSSDDFGIVSTIQEFNGIHITGVA
GDQQASLFGHGSPIGGCKSTYGTGCFVVKNIGDTIKEIPKGLLATVGWEINGKITYALEG
TVMTAGAALKWIRDIGILKDYNEISKIVTSKNGGVYFVPAFQGLGTPYWDDDVRGIIVGL
TSGTGKGELVRATLESIALQCAQVIEIMGKINEIKVDGGVSRSDCMLQFQADICNCTVIR
LKEKEITAMGAAMLAGLYVHLFKEDELDSMRVIEHVFKPQMSEEERKQIFSVWNKAVESA
RSFVH
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatccttgctattgatcaaggtactacaagtactagagttattctatttgat
gaaaagtgtcagtcaattcatacagaacaagaagaatttgattctatttttccacatcca
ggttgggttgaacaagatcctgaagtaatttatactagtgttgttaacttaatgaaaaaa
tgtcttgttaatactggcattaataaagaagacattgcagctattggaataactaatcaa
agagaaactacagttatgtgggataaaagaacaggaaaacctatttacaatgcaatagta
tggcagtctaaacaatcaggaaatgaaacatcttatcttatggagaaaggatatgaagag
atttttcagtctaaaactggactagtactaaatccttatttcagtgctagtaaaattatg
tggatatttaataatgtagaaggtgcaaaggcattagctgaagaaggtgttttattgttt
ggaactattgacacatggattatctataatctaactggaggtcaaagtcattctactgat
atatcaaatgcagcacgtactttattgtttaatatttatgaaaagaaatgggatgatgag
ttattagcaaaaacaaatattccaaagtctattctcccaatagttaaacaatcctctgat
gattttggtattgtttctactattcaggaatttaatgggattcatattactggagttgct
ggagatcaacaagcatcactttttggacatggaagtcctataggaggatgtaaatcaaca
tatggaactgggtgtttcgttgtaaaaaatattggagatacaattaaagaaataccaaaa
ggattattagcaactgttggatgggaaattaatggaaagataacatatgctcttgaaggc
acagttatgactgctggagcagcactaaaatggataagggatataggaatattaaaagac
tacaatgaaatatcaaaaattgttacttccaaaaatggtggagtttattttgtaccagca
tttcaaggacttgggacaccttattgggatgatgatgttcgtggcataattgttggacta
actagtggtactggaaaaggtgaattagttcgagctactctagaaagtattgctttacaa
tgtgctcaagtaattgaaattatgggaaaaattaatgaaattaaagtggatggaggggtt
tcaaggtctgattgtatgctccagtttcaagcagatatatgcaattgtactgttattaga
ctgaaagagaaagaaattactgcaatgggagcagctatgttagctgggttatatgttcat
ttatttaaagaagatgaattagactcaatgagagtaattgaacatgtatttaaacctcaa
atgagtgaagaagaaagaaagcaaatattttcagtttggaataaagcagtagaatcagca
cgttcatttgtccattag

  All links  
No link information was found.   
DBGET integrated database retrieval system