KEGG   Entamoeba histolytica: EHI_169320Help
Entry
EHI_169320        CDS       T00238                                 

Gene name
177.t00028
Definition
phosphatidylinositol3-kinaseTor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ehi  Entamoeba histolytica
Brite
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   EHI_169320 (177.t00028)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2342 aa AA seqDB search
MTTQMKWSDKFMSLFNELVSETSQTQNDIITKKLHDFVLIVVRDLQGDGVSTFINEISSD
LLAVLKKPEVNEKQHSAVINLIDFFITSDIDDSYPRTNAKDIIDCIMKSNNQNVIRNASV
VLGKIIRLGPHDLVEKELDIANSYLEREPKVNGALIMQQIGLNNQVICFMNQNKIIESLL
KGLYDRSINARTESQKALSILFNLFTSKESNNFDPEALYKQAVVYLKQTNSADLQHGALL
LMVSLLRNCKEYMKPKYNEVLQMFLNVKEHKSMVIRKTVITSLPYFAQFDCDSFAPKNEE
VIESFQKDRKSIADFAQFEHDELTRIKCEEPFNGIMNYLINSIKSFSDKSIVFTVIGDIT
REIKYEMYAFVEQVYAKMREIINSKEKKAEILNSIMYCMEQFIINIPVPRVFALIHKTFP
TLLELGLSTPLVSLINQSCIIYNNPTYRLQTQKLLLDVICGVLLGKAFIPFGAPEHLKMF
NRTIVPTVEGDDQIILALDTLHSFKFKHNIVPVVKECTMKYIDNETKKIRQEAAMLTQVL
LPPIDTTKKFISTLDVTEVLEKLLDHGLSDPESEIRITIMKLLDERFDSFLAQSRNVQTL
FVVLNDENLKVREYAIKIIGRLTHYNPAFVMPLFRKTIIRLLTQLQFINDLKTDEQVTLL
MGQLVKSSGKLTKPYVEPLLNILLPKLEEAINKSHSTICIYILNIIGDLTTIGSDSSQYT
PGLMKCIISVLQDKGNSQKKSLRRESALIALGKLVRSIGYVVQPYYDYPELLGLLIELAS
NERNQDIKIELIKVFGIIGAIDPYKYKLLTETEGANQNDDAETVESLLPISQAGTEEFYA
MTVIGLLLNILRDNNLVSGHEQTVKTFVKVICYLNRKTLPYIPQILSLYLKLFKTCTISV
RPALIKGLADIMYLIEKNIREYLPEIFTLIQECWDDTTVLPILQLVCEIAKVMHDEFKQY
MPQMLSLIISELNKYVFEQNSLVFERIINSIVILAEHIDFEDYLHLVIPSISDLVNEQVH
WSIVLPTLKALYKFLQYVNAEEFISRLVLPLTRLLQNEILRDATMDVFCSIADGLGKRFL
VYAPTIKFALNKYCPKYNNQRYESLTIKLQDTPDGLVLPIDENEGQNVTISEDLHAQVTS
FNQDTTIKPNADINKVIAVWETYRQRRSKEDWFDWFRQIAMVFLKESPSQSLCYCHLLST
DHFPLARDLFNYAFLSMWQDSTDNSQRLTNCLIKVLENNNTPHEIIQTILNLCEFMEREG
IKVPIKSLGDYSKKCNAYAKALHYKEQEFLENANINLIEELIGLNNQLQNYDAAAGLIEY
TKQIKQVQNNDTELNQTWYEKLGRWQQALSIYERKLQEDINNPELLVGKLNCLHELGDWE
SLDTTAKTLWKIGDKKAISSARSLYAAALWYLDDWNEFDSIVSEMTESNFENDFFKSINC
IHNEEFEEAKALINQQRIALDAELSSLVGEVYERSYSTIAKAQMLAELEEVIACKEGLYN
QDAKSILKSAWSEKLINAKADVSIWQKLLKIRSFVLTETENSESWIKFTGLCYKSGKYKL
AMKTLDRLAGINIENHLEELQPSKLRIGVQYLKLQWKGAKDLEEKKRLLNVLQNFADIIE
ERRGDDLNLKAVVCSKLGEWNLYIAQNSNAFNYETIPNILMYYHSTIQYDPESYKYWHHW
ALINFEIVSYIELDENYNEETLVDYLKVSIEAFVKSLILTKNNQTLQDTLRLLTILFKYG
KYQEVEEAIVEGIRALPVDIWLHVIPQIIARIQSNVPAVKRVMTDLLTTIGKKHPQALVY
PLTVASKSPSYDRRKTAMSVIEKIRTDSGHLVEQALLVSEELVRIAILWHEAWHEALEEA
SKEFYVNHSFDGMMAILQPLYDRLEKGGETQNERGFLQSYGKDLRDAFELCIRFKNKGKR
ASEKDHDIEGAWEIFFRIYKRIHKSINAVAVLELPHVSPRLMEAHDLDIAVPGTYKAQNV
NNIIRIKSIAPVLNIIPSKQRPRKLTIVGSNGKEYKYCLKGHEDLRQDERVMQLFGLVND
LLASNSITSTHHLFITCYDVIPLSTMSGLIGWVPHSDTLHQLIKEYRESHNIPVDFEKRL
INKICPRFDDLPFLQKVEVFEKVLAESSGMDLANILWLKSSSSESWIDRRTNFTRSVALM
SMVGYILGLGDRHPSNLMLQRFTGNVVHIDFGDCFEVAIHREKFPEKIPFRLTRMIVNAM
DVSGVEGTFRITCENVMAVLRENKDSLMAVLEAFVYDPLIVRLLGGKDVEDEDDKMNKES
QGENYVMKSKAVSVMRRVLEKLTGKDFGNEELNVHDQVDRLIREATSNENLSQSYQGWCP
YW
NT seq 7029 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagatgaagtggtctgataaatttatgtcattatttaatgagcttgtatca
gagacgagtcaaacacaaaacgacattataacaaagaaacttcatgattttgtacttata
gtagtaagagatcttcaaggagatggagtatctacatttatcaatgaaatatcttcagac
cttttagcagtccttaaaaaaccagaggtaaatgaaaaacaacatagtgcagtaattaat
cttattgatttctttattacttctgatattgatgattcatatcctcgaactaatgccaaa
gatataattgattgtattatgaaatcaaataatcaaaatgttattcgaaatgcatctgta
gtattaggaaaaattattcgattaggaccacatgatttagtagagaaagaattagacatt
gctaatagttatttagaaagagaaccaaaagttaatggagcattgattatgcaacaaatt
ggattaaataatcaagttatttgttttatgaatcagaataaaataatagaaagtttactt
aaaggattatatgatagaagtattaatgcaagaacagagtcacaaaaagcattaagtata
ttatttaatttatttacatcaaaagaatcaaataattttgatccagaagcattatataaa
caagcagtagtatatttaaagcaaacgaattcagcagatcttcaacatggagcattatta
ttaatggtaagtttattaagaaattgtaaagaatatatgaagcctaaatataatgaagta
ttacaaatgtttttaaatgtaaaagaacataagtctatggttattagaaaaactgttatt
acatcattaccatattttgcacaatttgattgtgattcatttgcaccaaaaaatgaagaa
gttatagaaagttttcaaaaagatagaaaaagtattgcagattttgcacaatttgaacat
gatgaattaacaagaattaaatgtgaagaaccatttaatggaataatgaattatttaatt
aattcaataaaatcatttagtgataaaagtattgtatttacagttattggagatattaca
cgagaaattaaatatgaaatgtatgcatttgtagaacaagtatatgcaaaaatgagagaa
attattaattctaaagaaaaaaaagcagaaatattaaattcaataatgtattgtatggaa
caatttattatcaatattccagtaccacgagtatttgcattaattcataaaacatttcca
acattattagaattaggattatcaacaccattagtatcattaattaatcaaagttgtatt
atatataataatcctacatatcgtcttcaaacacaaaaattattattagatgttatttgt
ggtgtgttattaggaaaagcatttattccatttggtgcacctgaacatttaaaaatgttt
aatagaactattgtaccaacagtagaaggagatgatcaaatcatattagcacttgataca
ttacattcatttaaatttaaacataatattgtaccagtagttaaagaatgtacaatgaaa
tatatagataatgaaacaaagaaaatacgtcaagaagctgcaatgttaacacaagtactt
cttccaccaattgacacaacaaaaaaatttatttctacacttgatgtaacagaagtatta
gagaaattgcttgaccatggattaagtgatccagaaagtgaaattagaataacaataatg
aaattattagatgaacgatttgatagttttcttgcacaatcaagaaatgttcaaacactt
tttgttgttttaaatgatgagaatttaaaagttagagaatatgctattaaaattatagga
agattaacacattataatcctgcatttgttatgccattatttagaaaaactattattcgg
ttattaacacaattacaatttattaatgatttgaagactgatgaacaagtaactttgtta
atgggtcaattagtcaaatcatcaggtaaattaactaaaccatatgttgaaccattatta
aatattttattaccaaaattagaagaagcaataaataaatcacatagtacaatatgtatt
tatatattaaatattattggagatttaacaacaattggaagtgatagtagtcaatataca
ccaggattaatgaaatgcataattagtgtattacaagataaaggaaattcacaaaagaaa
agtcttagaagagagtcagcattaattgcattaggaaagttagtaagaagtattggatat
gttgtacaaccatattatgattatcctgaattacttggattattaattgaacttgctagt
aatgaaagaaatcaagacattaaaatagaattaataaaagtatttggaattattggagca
attgatccatataaatataaattattaacagaaacagaaggagcaaaccaaaatgatgat
gcagaaacagtagaatcattattacctatttcacaagcaggaacagaagaattttatgca
atgacagtaattggattattacttaatattttaagagataataatcttgtttctggacat
gaacaaacagtaaaaacatttgttaaagttatttgttatttaaatagaaaaacattacca
tatattccacaaatattatcattatatttaaaattatttaaaacatgtactattagtgta
agaccagcattaattaaaggattagctgatattatgtatcttatagaaaaaaatattaga
gaatatcttccagaaatatttacattaattcaagaatgttgggatgatactacagtatta
ccaatattacaattagtatgtgaaattgctaaagttatgcatgatgaatttaaacaatat
atgcctcaaatgctttcattaattatatcagaactaaataaatatgtatttgaacaaaat
agtttagtatttgaaagaattattaattctattgttatattagctgaacatattgatttt
gaagattatcttcatttagttattccaagtattagtgatcttgttaatgaacaagtccat
tggagtattgttcttcctacattaaaagctttatataaatttttacaatatgttaatgca
gaagaatttattagtcggttagttcttccattaactagattattacaaaatgaaatatta
agagatgcaactatggatgtattttgtagtatagcagatggtcttggtaaaagattttta
gtttatgccccaacaattaaatttgcattaaataaatattgtccaaaatataataatcaa
cgatatgaatcattaacaataaaacttcaagacacacctgatggacttgtattaccaata
gatgaaaatgaaggacaaaatgttacaatatcagaagatcttcatgcacaagttacaagt
tttaatcaagatacaacaattaaacctaatgcagatataaataaagtaattgcagtatgg
gaaacatatagacaaagaagaagtaaagaagattggtttgattggtttagacaaattgct
atggtatttttaaaagaaagtccaagtcagtcattatgttattgtcacttattatcaaca
gatcattttccattagcaagagatttgtttaattatgcatttttatcaatgtggcaagac
tcaacagataattcacaaagattaactaattgtttaataaaagtattagaaaataataat
actccacatgaaattattcaaacaatattaaatttatgtgaatttatggaaagagaagga
attaaagttcctattaaatcacttggggattattcaaagaaatgtaatgcatatgctaaa
gcattacattataaagaacaagaatttcttgaaaatgctaatattaatttgattgaagaa
cttattggattaaataatcaattacaaaattatgatgcagctgctgggttaattgaatat
actaaacaaattaaacaagttcaaaataatgatacagaattaaatcaaacatggtatgaa
aaattaggaagatggcaacaagcattaagtatttatgaaagaaaattacaagaagatatt
aataatccagaacttcttgttggtaaattaaattgtttacatgaacttggagattgggaa
tctcttgatacaacagcaaaaacattatggaaaattggagataaaaaagcaatatcaagt
gcaagatcattatatgcagcagcattatggtatttagatgattggaatgaatttgattct
attgttagtgaaatgactgaaagtaattttgaaaatgatttctttaaaagtattaattgt
attcataatgaagaatttgaagaagctaaagcacttattaatcaacaaagaattgcatta
gatgccgaattaagttcattagttggtgaagtatatgaaagatcatattctactattgct
aaagcacaaatgttagcagaattagaagaagttattgcatgtaaagaaggattatataat
caagatgctaaaagtattttaaaatcagcatggagtgaaaaattaataaatgctaaagct
gatgtaagtatttggcaaaaattattaaaaataagaagttttgtattaacagaaacagaa
aatagtgagtcatggattaaatttacaggattatgttataaaagtggaaaatataaatta
gcaatgaaaactcttgatagattagctggaattaatattgaaaatcatcttgaagaatta
caaccaagtaaacttcgtattggagttcaatatcttaaattacaatggaaaggagctaaa
gaccttgaagaaaaaaagagattattaaatgtattacaaaattttgcagatattattgaa
gaaagaagaggagatgatttaaatctaaaagcagttgtatgttcaaaattaggtgaatgg
aatttatatattgcacaaaatagtaatgcatttaattatgaaactatacctaatatttta
atgtattatcatagtacaatacaatatgatcctgaaagttataaatattggcatcattgg
gcattaattaattttgaaattgtttcatatattgaattagatgaaaattataatgaagaa
acattagtagattatcttaaagttagtattgaagcatttgtaaaatcacttattttaact
aaaaataatcaaactttacaagacactcttagacttttaactattttatttaaatatgga
aaatatcaagaagtagaagaagctattgttgaaggtattcgtgctcttcctgttgatatt
tggttacatgttattccacagattattgctcgtattcaatcgaatgtaccagctgttaaa
agagtaatgacagatttattaactactattggtaaaaaacatccacaagcacttgtctat
ccattaactgttgcatctaaatcaccttcatatgatagaagaaagactgctatgtctgtt
attgaaaagattagaacagattctggacatcttgttgaacaagcattacttgtaagtgaa
gaacttgttcgtattgctattttatggcatgaggcatggcatgaagcacttgaagaagca
tcaaaagagttttatgttaatcattcatttgatggaatgatggcaattttacaaccatta
tatgatcgattagaaaaaggaggagaaacacaaaatgaaagaggatttttacaatcgtat
ggaaaagatcttagagatgcatttgaactttgtataagatttaaaaacaaaggaaaaaga
gcatcagaaaaagaccatgatatagaaggtgcatgggaaattttctttagaatttacaaa
cgaattcataaatctattaatgctgttgcagtattagaattacctcatgtctcaccaaga
ctaatggaagcacatgatcttgatattgcagtaccaggaacatataaagcacaaaatgtt
aataatattattagaattaaatccattgcaccagttcttaatattattccatctaaacaa
cgaccaagaaaacttacaattgttggatctaatggaaaagaatataaatattgtttaaaa
ggacatgaagatttaagacaagatgaacgtgttatgcaattatttggattagttaatgat
ttattagcaagtaattctattacttctacacatcatttgttcattacatgttatgatgtt
attccattaagtacaatgagtggattaattggatgggtacctcatagtgatacattacat
caactaataaaagagtatagagaaagtcataatattccagttgattttgagaaaagatta
ataaataaaatatgtcctaggtttgatgaccttccatttttacaaaaggttgaagttttt
gaaaaagttttagctgaatcttcaggaatggatttagcaaatattttatggctaaaaagt
tcttcttcagaatcttggattgatagaagaactaatttcactagaagtgttgctttaatg
tcaatggttggttatattcttggtcttggtgatagacatccatctaatctaatgttacaa
cgatttactggaaatgtggttcatattgattttggtgattgttttgaagttgctattcat
cgtgagaaattcccagaaaagattccatttagattaactagaatgattgttaatgctatg
gatgttagtggagtagaaggtacattcagaattacatgcgaaaatgtgatggcagtatta
cgagagaataaagacagtttaatggctgttttagaagcatttgtatatgacccattaatt
gtcagactacttggtggtaaggatgttgaagatgaagatgataaaatgaataaagaaagt
caaggtgaaaattatgttatgaaatctaaagctgtttctgttatgagaagagtattagaa
aaattaactggaaaagattttggaaatgaagagttaaatgtccatgaccaagtggatagg
ttgataagagaagcaacatcaaatgagaatcttagtcagtcatatcaaggatggtgtcca
tattggtaa

DBGET integrated database retrieval system