KEGG   Entamoeba histolytica: EHI_170420Help
Entry
EHI_170420        CDS       T00238                                 

Gene name
186.t00012
Definition
thioredoxin
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EHI_170420 (186.t00012)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 119 aa AA seqDB search
MRAFLALCLIAIASANVVSISTANFNDYVKGEKPVFIKFFAPWCGHCKRLAPIYEEFSNV
AATEFPNLIVAEVDCTQNQDICEHVQGYPTVILYKGNENIEFEGPRTVEALKEFIAQKI
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctttttagctttatgcttaatagccattgcttctgctaatgttgtttcaata
agtactgctaactttaatgactatgttaaaggagaaaaaccagtttttattaaattcttt
gcaccatggtgtggacattgtaagagacttgctccaatttatgaagaattctcaaacgtt
gcagctactgaattcccaaatttaattgttgctgaagttgattgtactcaaaaccaagat
atttgtgaacatgttcaaggatatccaacagttattttatacaagggtaatgaaaatatt
gagtttgaaggtccaagaactgttgaagctcttaaagaatttattgctcaaaaaatttaa

DBGET integrated database retrieval system