KEGG   Entamoeba histolytica: EHI_176140Help
Entry
EHI_176140        CDS       T00238                                 

Gene name
156.t00003
Definition
profilin
Orthology
K05759  
profilin
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MSWQSYVDSFLVGAGKGMGGAIIGLQGGVWAASANCTPSAQESVAIGTACASNIAGLQQT
GVVIGGKKYMITRVDADEGTAMGKKGAEGISIYKTKQAVIIGYFSDASVSAGQNSDATYK
CAKYLMDAGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaatcatatgttgattcattccttgtcggagctggaaaaggtatgggtgga
gccattattggacttcaaggtggtgtctgggctgcttcagctaattgcactccatcagct
caagaatcagttgctattggaactgcttgtgcttcaaacattgctggacttcaacaaact
ggtgttgttattggtggtaagaaatacatgattaccagagttgatgctgatgaaggaact
gctatgggtaagaaaggtgctgaaggtatctcaatttacaagaccaaacaagccgttatc
attggatatttctcagatgcttcagtctctgctggacaaaactctgatgccacctacaag
tgcgctaaatatcttatggacgctggatattaa

DBGET integrated database retrieval system