KEGG   Entamoeba histolytica: EHI_176170Help
Entry
EHI_176170        CDS       T00238                                 

Gene name
156.t00006
Definition
serine/threonine protein phosphatase PP1-2
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ehi  Entamoeba histolytica
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    EHI_176170 (156.t00006)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     EHI_176170 (156.t00006)
Protein phosphatases and associated proteins [BR:ehi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     EHI_176170 (156.t00006)
Transcription machinery [BR:ehi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     EHI_176170 (156.t00006)
Spliceosome [BR:ehi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    EHI_176170 (156.t00006)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MQDLSPERLDAIISKCFQERSLFPGKEFIKANEIKSLCSMAIRVIAQEPSLLQLKAPIYV
IGDLHGQFTDLLRYFDETKIDQDRYLFLGDYVDRGFRSIEIVVLVFALKVKYPDRFFLLR
GNHEAKNINHLYGFFDECKRRFDVDTWRNFCEVFRYLPVSALIEGKILCLHGGLSKDMQD
VSCLTQIARPTDIPEEGLLCDILWADPSTDTFGWEENMRGVSYTFGPDVALEFLKRNGIE
LLCRAHQVVEEGFKFCFNKKVLTLFSAPNYCNSFNNCGAMMRVDENLYCTFITLNPEGSD
SD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacttatctccagaacgccttgatgcaatcatttcaaagtgtttccaagaaaga
tcattatttccagggaaagaatttattaaagcaaatgaaataaagtcattatgttctatg
gcaattagagttattgcacaagaacctagtttacttcaattaaaagcaccgatatacgtt
attggagatttacatggacaatttacggacttacttagatattttgatgaaacaaaaatt
gatcaagatagatatttatttcttggtgattatgtagatagaggatttcggtcaatagaa
attgttgtattagtatttgctttaaaagtcaaatatcctgatagatttttcttattaaga
gggaatcatgaagcgaagaatattaatcatttatatggcttttttgatgaatgtaaaagg
agatttgatgttgatacatggagaaatttttgtgaagtttttagatatcttcctgttagt
gcattaattgaaggtaaaatactttgtttacatggaggattaagtaaagatatgcaagat
gtttcttgtttaacacaaattgcacgaccaactgatattccagaagaaggattattatgt
gatattttatgggcagatccatctactgatacttttggatgggaagaaaatatgagggga
gtttcatatacatttggaccagatgttgctttagaatttttaaagagaaatggtattgaa
ttattatgtcgtgcacatcaagtagtagaagaaggatttaaattttgttttaataaaaaa
gtattaacattatttagtgctccaaattattgtaatagttttaataattgtggagcaatg
atgagagtcgatgaaaatttgtattgcacttttattactcttaatcctgaaggaagtgac
tctgattga

DBGET integrated database retrieval system