KEGG   Entamoeba histolytica: EHI_177540Help
Entry
EHI_177540        CDS       T00238                                 

Gene name
20.t00034
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ehi  Entamoeba histolytica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EHI_177540 (20.t00034)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EHI_177540 (20.t00034)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MNESISVSTAPVTPQNELEKTYDGSIQLIIGPMFSGKTTELIRLIKRFRYSKKTTVVIKY
SKDTRYGSEDEAISHDKESWKAIPTMKLMPVLETALNYEVIGIDEGQFFPDLIEFSEACA
SYGRLVIIAALDGTFQRKPFGQITDLIPLCESVKKLSAVCVNCGKKAAFSLRTSSEESIE
VIGGVDKYCAVCRKCFYKDGATLKTQRSVEFASHISEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaagtataagtgtgtctactgctcctgttacaccacaaaatgaattagaaaaa
acatatgatgggtctattcaattaattattggtcctatgtttagtggtaaaactactgaa
ttaataagacttattaaaaggtttagatattccaaaaaaactactgttgttattaaatac
tctaaggatactaggtatggatcggaagatgaagctatttctcatgataaagaatcatgg
aaagctattccaaccatgaaattaatgccagtacttgaaaccgctcttaattatgaagtt
attggtattgatgaaggtcagttcttcccagacttaatagagttttcagaggcatgtgca
agttatggaagattggtaatcatagcagcattagatggtacattccaaagaaaaccattt
ggacaaattactgatcttattccattatgtgaaagcgtaaaaaagttaagtgctgtttgt
gttaattgtggtaaaaaagcagctttttcattaagaaccagttcagaagaatcaattgaa
gttattggaggagtagataaatattgtgctgtctgtagaaaatgtttctacaaagatggt
gctacattaaaaactcaaagaagtgttgaatttgcttctcacataagtgaactataa

DBGET integrated database retrieval system