KEGG   Entamoeba histolytica: EHI_177540Help
Entry
EHI_177540        CDS       T00238                                 

Gene name
20.t00034
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ehi  Entamoeba histolytica
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ehi00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 218 aa AA seqDB search
MNESISVSTAPVTPQNELEKTYDGSIQLIIGPMFSGKTTELIRLIKRFRYSKKTTVVIKY
SKDTRYGSEDEAISHDKESWKAIPTMKLMPVLETALNYEVIGIDEGQFFPDLIEFSEACA
SYGRLVIIAALDGTFQRKPFGQITDLIPLCESVKKLSAVCVNCGKKAAFSLRTSSEESIE
VIGGVDKYCAVCRKCFYKDGATLKTQRSVEFASHISEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaagtataagtgtgtctactgctcctgttacaccacaaaatgaattagaaaaa
acatatgatgggtctattcaattaattattggtcctatgtttagtggtaaaactactgaa
ttaataagacttattaaaaggtttagatattccaaaaaaactactgttgttattaaatac
tctaaggatactaggtatggatcggaagatgaagctatttctcatgataaagaatcatgg
aaagctattccaaccatgaaattaatgccagtacttgaaaccgctcttaattatgaagtt
attggtattgatgaaggtcagttcttcccagacttaatagagttttcagaggcatgtgca
agttatggaagattggtaatcatagcagcattagatggtacattccaaagaaaaccattt
ggacaaattactgatcttattccattatgtgaaagcgtaaaaaagttaagtgctgtttgt
gttaattgtggtaaaaaagcagctttttcattaagaaccagttcagaagaatcaattgaa
gttattggaggagtagataaatattgtgctgtctgtagaaaatgtttctacaaagatggt
gctacattaaaaactcaaagaagtgttgaatttgcttctcacataagtgaactataa

DBGET integrated database retrieval system