KEGG   Entamoeba histolytica: EHI_178890Help
Entry
EHI_178890        CDS       T00238                                 

Gene name
15.t00006
Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
ehi  Entamoeba histolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHI_178890 (15.t00006)
Translation factors [BR:ehi03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    EHI_178890 (15.t00006)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 213 aa AA seqDB search
MSWEDFDIAEEPDFGETTSTLAALAPETKEETKIVSNKELKEAKKNNVKVAEEYVDPTEG
MTEEEKALALRRQQEESDIKGAERLYQGVDDLHELDTMSVITDKDFQKYGKLLGLKGHSL
YKEKSKQYKLLVKECMRELTNDLTSVEIKELSAYMEVLFNQQVQIEKEADKKKKKGGKKN
LAKPATTGKKYTERVEDQLEDDYYDDEDDYDFM
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggaagattttgatattgcagaagaacctgattttggagaaactacttctaca
ttagcagctttagcaccagaaactaaagaagaaacaaaaattgttagtaataaggaattg
aaagaggcaaagaaaaataatgtaaaagttgcagaagagtacgtcgacccaactgaagga
atgactgaagaagaaaaggcattagccttgagaagacaacaagaagagtcagatattaaa
ggggcagaaagattatatcaaggtgttgatgatttgcatgaattagatactatgtcagtc
attactgataaagatttccaaaagtatggtaaattattaggattaaaaggtcactctctt
tataaagaaaagtcaaaacaatataagttacttgttaaagaatgtatgagagaattaact
aatgatttaacaagtgttgaaattaaagaattaagtgcttatatggaagtactttttaac
caacaagttcaaatagagaaagaagctgataaaaagaaaaagaaaggaggtaaaaagaat
ttagctaaacctgctacaactggaaagaaatatactgaaagagtagaagaccaactcgaa
gatgattattatgatgatgaagatgattatgacttcatgtaa

DBGET integrated database retrieval system