KEGG   Entamoeba histolytica: EHI_180000Help
Entry
EHI_180000        CDS       T00238                                 

Gene name
26.t00045
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ehi  Entamoeba histolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHI_180000 (26.t00045)
Translation factors [BR:ehi03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    EHI_180000 (26.t00045)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 200 aa AA seqDB search
MSVKVLEPHQLTMTLNAEPIDGQHKLNTSWTLWYDQPSNESIPYGSNTKEVYCFGTVENF
WRMYNNIIKASDLVCMSSYYLFRKGIEPKWEDAQNKNGGRWIHYCSKTMKNEGIEEKWLN
TILACIGEDFPSSELVKGCVFNCKKNQIRISLWVGEHDDSKAVKLIGSKFKSILDLDQEK
IVFHIHQDSVDGRFFNVISL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgaaagtattagaaccacatcaattgactatgacgttaaacgctgaacctatt
gatggtcaacataaattaaatacttcttggacattatggtatgaccaaccttcaaatgaa
agtattccgtatgggtcaaacacaaaagaggtttattgttttggtactgttgaaaacttt
tggagaatgtacaacaatatcatcaaagcctctgatttagtttgtatgagtagttattat
ctatttagaaagggtattgaaccaaaatgggaagatgcacaaaataaaaatggaggtaga
tggattcattattgtagtaaaactatgaagaatgaaggaattgaggaaaagtggttaaac
actattttagcatgcattggagaagattttccttcaagtgagttagtcaaagggtgtgtt
tttaattgtaaaaaaaatcaaataaggatttctttatgggtaggggagcatgatgattct
aaagctgtgaaattgattggaagtaagtttaaatcaattcttgaccttgatcaggaaaaa
atagtcttccatattcaccaagattctgttgatggacgtttctttaatgttatcagttta
taa

DBGET integrated database retrieval system