KEGG   Entamoeba histolytica: EHI_182990Help
Entry
EHI_182990        CDS       T00238                                 

Gene name
35.t00014
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 133 aa AA seqDB search
MSDKASQKKSVATKDATKPKKAGDEEKKTMLKKNFESYALYISRVLKSVFQDIGITLPSI
SIMDSFVRDIFERIATEASSLARNYNKTTITVKEIETATKLILKGDLNKHAVSEGQSAVK
RASGKGSTSGSQV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaagccagtcaaaagaaatctgttgctactaaagacgctaccaagccaaaa
aaagctggagatgaagaaaagaaaactatgctcaagaagaattttgagtcatatgccttg
tacatttcaagagttttgaaatcagttttccaagatattggaattacacttccatctatt
tctattatggattcatttgttcgtgatatttttgaaagaattgctactgaagcttcatct
cttgcaagaaattacaataaaaccaccatcactgtcaaagaaattgaaacagccactaaa
cttattcttaaaggtgatttgaataaacatgcagtttctgaaggacaatcggctgttaag
agagcatctggtaaaggaagtacttcaggatctcaagtttaa

DBGET integrated database retrieval system