KEGG   Entamoeba histolytica: EHI_192400Help
Entry
EHI_192400        CDS       T00238                                 

Gene name
7.t00062
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ehi  Entamoeba histolytica
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ehi03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ehi03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MENNIIEKDIIKYFQVLPEIAMKSAYKSKWTCSEIFRLLPGMCQSLLLRIIFLTERISIN
EMYNQFKIPNETMDEVINTIHSIHIIDKEEEDGILYIKLNNDFQSNFKMNLTGSMEPAYK
IKEVNEKVSKIIQEKCLKENCIKTFEYFMNKLLQFNSQPNISNNPLRIFKDLELVKEETR
QITRKGYQFLFQETKTQLWVIMLSIIGLIQRRISPFINDVFEMTYLKEHIIYNCDHFKKV
YGPDPLQLFNDLGIIVYYKEQNVMAITPLMSLLRSNANIPSDLVKKPKTITEINYSVYIY
TESQFQVDLYRLFIRKNFQLANLWVGKLNHQSVTEAFAKGITSEMLINFLQPNLPRTIQK
QIDLWKKEINRFKEEHVVRYRFYDDAIGRQLFVIVKNESDRLKATILEKEDIRLIFVKYQ
YGETIRSFMKKKERELLLKQPRPSSTSLPLSLSTDNSKNNIHSGIKRNVPEGIKPKPSKK
YIVD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatataatagaaaaagacattattaaatattttcaagttttaccagaaata
gccatgaaatcagcatataaatcgaagtggacatgttcagaaatatttcgattattacct
ggaatgtgtcaaagtttgttattaagaattatttttctaacggaaagaatcagcataaat
gaaatgtacaatcaatttaaaataccaaatgaaacaatggatgaagtgattaatacaatc
catagcattcatattattgataaagaagaagaagatggaattttgtatataaaactcaac
aatgactttcaaagtaattttaaaatgaatcttacggggtcaatggagccagcatataaa
attaaagaagttaacgaaaaagtatcaaaaataattcaagagaaatgtttaaaagaaaat
tgtattaaaacatttgaatattttatgaataaattacttcaatttaatagtcaaccaaat
atttcaaataatccattaagaatatttaaagacttagaattagttaaagaagaaacaaga
caaataactcgaaaaggatatcaattcttatttcaagaaacaaaaacacaactttgggtt
attatgcttagtattattggacttattcaaagaagaatatcaccatttattaatgatgtt
tttgaaatgacatatttaaaagaacatattatttataactgcgatcattttaaaaaagta
tatggaccagacccacttcaattatttaatgaccttggtattattgtatattataaagag
caaaatgttatggcaattactccattaatgtctcttcttcgatcaaatgctaatattcca
agtgaccttgtaaaaaagcctaaaacaataactgaaattaattattctgtttatatttat
acagagagtcagtttcaagttgatttatatagactatttattagaaagaatttccaatta
gctaatttatgggttggaaaacttaatcatcaatcagtaacagaggcatttgcaaaagga
attactagtgaaatgttaattaatttcttgcaaccaaatttaccaagaacaattcaaaaa
caaattgatttatggaaaaaagaaataaatcgttttaaagaagaacatgtagttcgttat
agattttatgatgatgcaattggaagacaattatttgttatagttaaaaatgaaagtgac
agattaaaagcaacaatattagaaaaagaagatattagactaatatttgtaaaatatcaa
tatggagaaactattcgatcattcatgaaaaagaaagaaagagaacttttattaaaacaa
ccacgtccttcttctacttctcttcctctttcattatcaactgataattcaaaaaacaat
attcattcaggtattaaaagaaatgttcctgaaggtataaaacccaaaccatcaaagaaa
tacattgttgattga

DBGET integrated database retrieval system