KEGG   Entamoeba histolytica: EHI_193350Help
Entry
EHI_193350        CDS       T00238                                 

Gene name
139.t00015
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ehi  Entamoeba histolytica
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    EHI_193350 (139.t00015)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     EHI_193350 (139.t00015)
Transfer RNA biogenesis [BR:ehi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    EHI_193350 (139.t00015)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 317 aa AA seqDB search
MSFDKELALALEIVQVSCKITTSVAEHTLTDQTQIKNDKSPVTVGDYSVQAYVNKKIHET
FPEDQIVAEEDTKTIPEDIFAKVCKHVQIYSDMKDDEIRKSIDLGNSTGGKGRHWVLDPI
DGTLGFLRREQYAVCLAFMIDGDIKVGVLGCPNFEGGLIVAAQKGCGAKMFSVNDIKNGK
DIHVSTTPKTSDMCFCESVEVSHTDQSRSKTITERLQVTKPPVRMDSQCKYMAIASGRAD
VYLRLPRNLSYQEKIWDHAAGYLIVKEAGGKVTDIYGNDLDFSLGRTLCNNHGIVASNGI
LHEETVNVVKDVLSDLK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttgataaagaacttgcacttgctttagaaattgtacaagtatcatgtaaaatc
actacttcagtagcagaacatacattaactgatcaaactcaaattaaaaatgataaatca
ccagtaacagttggagattattcagttcaagcttacgtaaataaaaaaattcatgaaact
ttcccagaagatcaaattgttgctgaagaagatactaaaactattccagaagatatattt
gctaaagtttgtaaacacgttcaaatatattcagatatgaaagatgatgagattagaaaa
tctattgatcttggaaatagtactggtggaaaaggaagacattgggtcttagatccaatt
gatggaacacttggatttttaagaagagaacaatacgctgtttgtttagcatttatgatt
gatggtgatattaaagtaggagttcttggatgtcctaattttgaaggtggtttaattgtt
gctgcacaaaaaggatgtggagctaagatgtttagtgtgaatgatattaagaatggaaaa
gatattcatgtctcaacaactccaaaaacatctgatatgtgtttctgtgaatctgttgaa
gtgtctcatactgaccaatctcgttctaaaactattactgagagattacaagttactaaa
ccaccagtacgtatggattctcaatgtaagtatatggcaattgcatctggtagagctgat
gtttatttaagacttccacgtaatctttcttatcaagaaaagatttgggatcacgctgca
ggttatttaattgttaaagaagctggaggaaaagttactgatatttatggtaatgatctt
gacttttcacttggaagaactctttgtaacaatcatggtattgtcgcttctaatggaatt
cttcatgaagagactgttaacgtcgtaaaagatgtactttctgatttaaaataa

DBGET integrated database retrieval system