KEGG   Entamoeba histolytica: EHI_194420Help
Entry
EHI_194420        CDS       T00238                                 

Gene name
46.t00053
Definition
protein kinase domain containing protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     EHI_194420 (46.t00053)
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   EHI_194420 (46.t00053)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EHI_194420 (46.t00053)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 340 aa AA seqDB search
MNSRTIQIKNNSYEDPFTQGYALQGLIDKGSEGIVYSILHKKSGQLLACKKIEVGESRIN
NLRVLQEIRLLKYLNHENIIHLEEYLFAQIESINTVFLVYELFPRNLSESIKSGRITAST
QMKYIVSQLASALYYLHINNFIHRDVKPSNILINDRFKIKLCDFGSCKCLNQKESYPTIQ
TVCTKIYMPPEYFYEGVEENTTIDIWQLGCVYTQMILRTPPFKGHSVSSIKKSILSLIKP
EEIIKINNNEEVNESYGLKETKTILPYFFRTLKIDSSSQELIYDMLQIDPLKRITAIEIL
QHQSIAMFKQPLGEKESHEFEFVKGNETYDEIVQLIKNEM
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccgtacaatacaaataaaaaacaattcatacgaagatcccttcactcaagga
tatgctttacaaggactgattgataaagggtcagaaggtatagtttattctattttacac
aaaaaatcaggacaattactggcatgtaaaaaaattgaagttggagagtcaagaataaat
aatctaagagtactacaagaaattagactcttaaaatatttaaaccatgaaaatattatt
catttagaagagtatctttttgctcaaattgaatctattaatactgtttttctagtctat
gaactttttccaagaaatttatcagagagtatcaaatcaggaaggattactgcatccaca
caaatgaaatatattgtttcacaattggcttctgcattatattatttacacattaataat
tttattcatcgagatgttaaaccaagtaatatattaatcaatgataggtttaaaataaag
ttgtgtgattttgggtcatgtaaatgtttaaatcaaaaagaatcatatccaacaattcaa
actgtatgtaccaaaatttatatgccaccagaatatttttatgaaggagttgaagaaaat
actactatcgatatttggcaattgggttgtgtttatacacaaatgattttaagaacacca
ccatttaaaggtcattctgtaagttctattaaaaaatctattttgtcattaattaaacca
gaagaaataattaaaattaataacaatgaagaagtaaatgaatcatatgggttaaaagaa
actaaaactattttaccttatttttttagaacattaaaaattgattcttcttcacaagaa
ttaatttatgatatgttacaaatagacccattaaaaagaattacagcaattgaaattcta
caacaccaatcaattgctatgtttaaacaaccattaggtgaaaaagaaagtcatgaattt
gaatttgtaaaaggaaatgaaacttatgacgaaattgttcaattaataaaaaatgaaatg
taa

DBGET integrated database retrieval system