KEGG   Entamoeba histolytica: EHI_195050Help
Entry
EHI_195050        CDS       T00238                                 

Gene name
20.t00061
Definition
tyrosine kinase
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1697 aa AA seqDB search
MFQKILIMVAAFGVVRCLTQCYDECPYCLWGLCHACTKGCNYGSWQDNAFCSYCFKCKRG
CEACDEEYHCTKCNLGYWLRKYSSEVSLCEKCPTGCLECSSPTQCSSCSKGYYLDNGMCY
QCPIGCSLCSGPDSCITCERNYGVVVYGDSSWCSPCTTIRCSSCQVGTYLSNGLCSACPN
ECTTCNTFNECAGCKDGYYLENGKCVLCSNKLKGCTSCDITGSVCYECTTRYRLSQGSCI
GCPTERGEGVDMCNNKGWQTICQYGYADPYGGCEKCNGGDACLTCTYTENRCQSCKDGYY
LNRNKCDKCDVLGCAWCQDDHTSCKRCKEGYLLKNGECVSCTELPECEYCSNECKRCSKG
YAFDSQHTCTKCSNCEECNTQTCFVCNSGYTISTGNNCDLCSNVFSHCASCKTTDRYCNS
CEQGYVFSTINKDCELCNVSFPHCSSCSQTDKVCLYCEDGYTLVNGQCVTCDKAMIGCST
CNNDKAKCASCSAPLVLASDSLSCKNCSSYFEHCLECSQVSYKCVNCDVGYVPVNGICTP
CQEGISECVKPTNGQCPIGTSPYKGFCYDCKKKLNNCDLCSQTEWKCHTCQKGLLNKDGI
CSTCDITNCVTCSTTEYKCDQCIDEYVPLGKKCLTCGNDPNCYKCNNDMTCSYCKLGYNL
YEGTCTPCSDTNAGCVSPIKEGKCKYNNFLYQNYCYECSKYKPNWLGWSNSSPNWLGWKN
GYGLKEDKTWVKWETGWSLGYKAEQWEKWQEGYMVRKGKWYKFESDNCDTNCYNSSIGCT
ACSTTKIEEESNGICLLCSIKNCKVCDYNLKTCIVCEDGYVYDSYTKQCTVKPGDLCEVY
KTSSCIKCRDGYAVDYINNKCIKCGNNCKTCRYTNGHFKCLSCDSSLNLYLLNSQCVSPT
NEKCNVVGFDSCRSCINNTKVVDGECKECSAHCLRCSQDECLQCDTSTILQNGKCVENLD
CLITNEYGSCSKCVSTKVLNSETSLCESCPENCKECLSSTNCHECMNGYVLYNQTNCIKL
ANTKLRLKRLTNSIIPHCEKETTVGCQRCDSGYYLTDILMCDPCIENCEQCNDSTTCQKC
SSGYILNNSVCVKQGRKGCKVITQNGERCAICEDGYFYKDGSCEKCDSSCLTCSKKSLFC
LQCAENFYFVSSNTCYNYSTIEYCLAANENGCTLCENGTYLTNYKCLKCGLGCLFCEDDS
GDCLSCKKDNVLIEGKCKSYIEITHCISEHDSRCSQCERGYEISNNGTSCDEKSKWWISL
ISVGILLILFLSAIISILAIINFLRNRKKKREQEKTTCIFNMKYSNVQFSLFETVKGIAL
NKQCIVYDGNIKVNQETKELICVGNTSKHVIKIQITLKENTYKFETRTTPQLVSLKPGQA
CEFEIFIKPLCSCSMKDEIILLASDLNNGIQYQGYIPLQFETELSTRLDPEELKEEKKIG
EGSFGIVYVGEFRGNKVAIKKMKQIEKSEDKLKEFEKEVAMLDKFRDEYIIHFYGAVFIP
NKICMVTEYAEYGSIQDIMNKRKITEISKKIRIKFMIDGAKGISYLHSNGILHRDIKPDN
FLVVSLDDNIEVNCKLTDFGSARNINMMMTNMTFTKGIGTPKYMAPEVLNRQHYKMPSDI
YSFAVTMLQIITWQDPFPKSEFRFPWSIANATAQGQRPSLINEVQEPIRSLITSAWCQES
SKRIKAEEIISCLEAVY
NT seq 5094 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagaaaatacttattatggttgcagcttttggtgtagttcgttgtttaacacaa
tgttatgatgaatgtccttattgtttatgggggttatgtcatgcatgtaccaaaggatgt
aactatggttcatggcaggataatgccttctgttcatattgttttaaatgtaaaagagga
tgtgaagcatgtgatgaagaatatcattgtacaaaatgtaatttaggatattggttacga
aaatattcatctgaagtaagtctatgtgaaaagtgtccaactggatgtttggaatgttca
tcaccgacacaatgttcatcatgttctaaaggatattatttagataatggaatgtgctat
caatgtcctattggttgtagtttatgttctggtcctgattcttgcattacttgtgaaaga
aattatggtgttgttgtttatggagattctagttggtgtagtccatgtacaacaattcgt
tgttcttcatgccaagttggaacatatttgtctaatggattatgctctgcatgtcctaat
gaatgtacaacatgcaacacttttaatgaatgtgctggatgtaaagatggatattatttg
gagaatgggaaatgcgttctttgttcaaacaaactcaaaggatgtacttcttgtgatatt
actggaagtgtttgttatgagtgcacaacaagatacagactttcacaaggatcatgtata
ggatgtcctactgaaagaggagaaggagttgatatgtgtaataataaaggatggcaaact
atctgtcaatatggatatgctgatccatatggtggttgtgaaaagtgtaatggaggagat
gcatgtttaacttgtacttatacagaaaatagatgtcaaagttgtaaagatggatattat
ttaaatcgtaataaatgtgataaatgtgatgttttaggatgtgcatggtgtcaagatgat
catacttcatgcaaacgatgcaaagaaggatacttattaaagaatggggaatgtgtgtct
tgcactgaactaccagaatgtgagtattgtagtaatgaatgtaaaagatgctcaaaagga
tatgcatttgatagccaacatacttgtactaaatgtagtaattgtgaagagtgtaataca
caaacgtgttttgtttgtaattctggatataccatttcaactggtaataattgtgattta
tgttctaatgtatttagtcattgtgcatcttgtaaaactacagaccgttattgtaattct
tgtgaacaaggatatgtcttttctacaattaataaagattgtgagttatgtaatgtttca
ttcccacattgttcttcttgtagtcaaactgacaaagtatgtttatattgtgaggatgga
tatacattagtaaatggtcagtgtgttacatgtgacaaggcaatgattggttgttcaaca
tgtaataatgacaaggcaaaatgtgcatcatgttcagctccattagtgttggcatcagat
tcattaagttgtaagaattgctcaagctattttgaacattgtctagagtgtagtcaagta
tcttataaatgtgttaattgtgacgtaggatatgttcctgttaatggtatttgtactcca
tgtcaagaaggaattagtgaatgtgtcaagccaacaaatggacaatgtccaattggaaca
tcaccatataagggattttgttatgactgtaagaaaaaattaaataattgtgatttatgt
tctcaaactgaatggaaatgtcatacttgtcaaaagggacttctaaataaagatggtatt
tgttccacttgtgatattactaattgtgtaacgtgttcaacaacagagtataaatgtgat
caatgtattgatgaatatgttccattaggaaagaagtgtttaacatgtggaaatgaccca
aattgttataaatgtaataatgatatgacttgttcatactgtaaacttggatataatctt
tatgaaggtacttgtaccccatgttctgatactaatgctgggtgtgtttcaccaataaaa
gaaggaaaatgtaaatataataatttcctttatcaaaactattgttatgaatgttctaaa
tataaacctaattggctaggatggtctaattcatcaccaaactggcttggatggaaaaat
ggatatggactaaaagaagataaaacatgggtaaaatgggagactggatggtcattgggg
tataaagctgaacaatgggaaaaatggcaagaagggtatatggtgagaaaaggaaaatgg
tataaatttgagagtgataattgtgatactaattgttataactcaagtattggatgtact
gcatgttccacaactaaaattgaagaagaatcgaatggaatttgtttattatgttcaatt
aaaaattgtaaagtgtgtgattataatttaaagacatgtattgtttgtgaggatggatat
gtttatgattcatacaccaaacaatgtactgtcaaaccaggtgatttgtgtgaagtatat
aaaacatcatcatgcattaagtgtcgagatggttatgcagttgattatattaataacaag
tgtattaagtgtggtaataattgtaaaacatgtagatatactaatggtcatttcaagtgt
ctatcatgtgactcttcattaaatttgtacttattaaattcacaatgtgtttctccgaca
aatgagaagtgtaatgttgtaggatttgatagttgtagatcatgtattaataatacaaag
gtagttgatggagaatgtaaagaatgttcagcacattgcttgagatgttcacaagatgag
tgtcttcaatgtgacacatcaaccattcttcaaaacggtaagtgtgttgaaaatctggat
tgtttaattacaaatgaatatggaagttgttcaaaatgtgtttcaacaaaagtattaaat
tctgaaactagtctttgtgagtcatgcccagagaattgtaaagaatgtttatcgtcaaca
aattgtcatgaatgtatgaatggttatgttttatataatcaaactaattgtataaaatta
gcaaacacaaagttaaggttgaaaagattaactaattcaataattcctcattgtgaaaaa
gaaacaacagttggatgtcaacgttgtgatagtggatattatcttacagatattttgatg
tgtgatccttgtattgaaaattgtgaacaatgtaatgattcaacaacatgtcaaaaatgt
tcttcaggatatattttaaataatagtgtctgtgttaaacaaggaagaaaaggttgtaaa
gttattacacaaaatggtgagagatgtgcaatatgtgaagatggatatttctataaagat
ggaagttgtgaaaaatgtgattcttcatgtttgacatgttctaaaaagagtttgttctgt
cttcaatgtgctgaaaacttctattttgtttcttcaaatacatgctataactattcaact
attgaatattgtttagcagcaaatgaaaatggatgtacgttgtgtgagaatgggacgtat
ttaacaaattataaatgtctcaagtgtggcttaggttgtttgttttgtgaagatgatagt
ggtgattgtttatcttgtaaaaaggataacgtattaattgaaggaaaatgtaagtcttat
atcgagataacacattgtatttcagaacatgactcaagatgttctcagtgtgaaagaggt
tatgaaatttctaataatggaacatcgtgtgatgaaaagagtaagtggtggatttcttta
atatcagtaggtattttgttgattttattcctcagcgccattatttctatattagccatt
atcaatttcttaagaaacagaaaaaagaaaagagaacaagagaaaacaacatgcatattt
aatatgaaatactccaatgtacaattctctttgtttgaaacagtaaagggaattgcatta
aacaaacaatgtattgtatatgatggtaatatcaaagtgaatcaagaaactaaagaatta
atttgtgttggaaacacttctaaacatgtaataaaaatacaaataactcttaaagaaaat
acttataaatttgaaactagaacaaccccacaattagttagtttaaaacctggacaagca
tgtgagtttgaaatatttattaagccattgtgtagttgtagtatgaaagatgagattatt
cttcttgcttctgatttaaataatggaattcagtatcaaggatatattcctttgcagttt
gaaacagaattatcaacacgacttgatccagaagaattaaaagaagaaaagaaaatagga
gaaggatcatttggaattgtttatgttggagaatttagaggaaataaagtagcaattaag
aaaatgaaacaaattgagaaaagtgaagataaactgaaagaatttgagaaagaagtagca
atgttagataaatttcgagatgaatatatcattcatttttatggagcagtatttattcct
aataaaatatgtatggtaaccgaatatgcagaatatggatcaatacaggatataatgaat
aaaagaaaaattacagaaatatcaaagaaaataagaatcaaatttatgatagatggagca
aaaggaatatcatatcttcattcaaatggaatattacatcgagatattaaaccagataat
ttccttgttgtatcacttgatgataatattgaagttaattgtaaattaacggattttgga
agtgcaagaaacatcaatatgatgatgacaaatatgacattcacaaaaggaataggaaca
ccaaaatacatggcaccagaagtgttaaatcgtcaacattataaaatgccatcagatata
tattcttttgcagttacaatgttacaaatcattacatggcaagatccatttcctaaatca
gaatttagatttccatggtcaattgccaatgcaactgcacaaggacagcgcccttctctt
ataaatgaagttcaagaaccaattagatcattaattacatccgcctggtgccaagagtct
tcaaaaagaataaaagcagaagaaataatttcttgtttagaagctgtatattga

  All links  
No link information was found.   
DBGET integrated database retrieval system