KEGG   Entamoeba histolytica: EHI_197070Help
Entry
EHI_197070        CDS       T00238                                 

Gene name
92.t00023
Definition
steroid 5-alpha reductase
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     EHI_197070 (92.t00023)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MNSESIYYLFLLVMVILGFIVFVLLHYVTAGYGMFQTDKWGVTINNRIGWCIMEIVSMIG
MLIFYVYSSVDEIVPIISLILFVIHYFRRSIIFPLRMSKGGKMPIIIMLMGMVFNLCNCY
VQAGWLFLYHPPHYYLGWFNTPQCYFGVLVFFVGMAINVHSDEIIRNLRKEGETEHKLPQ
GGLFDYVTSAQYFGELVEWLGFSIFTLSPGAIVFFLWTFANLMPRARSVHLAYRRKFKNQ
VGDRKILIPFIY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtgaaagtatatattatttatttcttcttgtaatggtgatacttggatttatt
gtatttgttctacttcattatgttactgctggatatggaatgtttcaaactgataaatgg
ggagtgacaataaacaacagaattggatggtgtattatggaaattgtatcaatgataggt
atgcttatcttttatgtctattcttctgtagatgaaatagtcccaataatttcattaatt
ctttttgtaattcattattttagaagaagtattattttcccattaagaatgtcaaaagga
gggaaaatgcctattattataatgttaatgggaatggtatttaatttgtgtaattgttat
gtacaagcaggatggttatttttgtatcatccaccacattattatttaggatggtttaat
actccacaatgttattttggagtgttagtcttttttgttggaatggcaattaatgttcat
tctgatgaaataataagaaatcttcgtaaagaaggagaaacagagcataaattacctcag
ggtgggttatttgattatgttacatctgctcaatattttggagaattagttgaatggtta
ggtttttctatatttacattatctccaggtgctattgtattttttctctggacatttgct
aatcttatgccaagagcaagaagtgttcatttggcttacagaagaaagttcaaaaaccaa
gttggggatagaaaaattttaattccatttatttattaa

DBGET integrated database retrieval system