KEGG   Entamoeba histolytica: EHI_199610Help
Entry
EHI_199610        CDS       T00238                                 

Gene name
45.t00006
Definition
ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     EHI_199610 (45.t00006)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHI_199610 (45.t00006)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 584 aa AA seqDB search
MSLDVEQQIQRQINEFLPKKLKFIKTETINPTAKKTISIDNRIDVDYDDAEELMKWKLKN
GRNAGRGYFNAHSNCYMISVLQVLTHTAPFYNYMTQQKIKVDDIFFKELERIMKEAFEKN
NQPLKPIVFEKNLKKLSSSLQRYQQEDATEFYLLLLDHLHEAIIGKGKNKISAISSIFHV
ELVSRITCYNCTRFNDHDEHFSVLPIEITKQKTLESGFDQFFKKEMISHYHCEKCNTKSN
VSKYYFFKRLPWILPIQLKRFTWDEKKINGKVAFPLQLNISKYGMDGLYDLYAIVVHLGK
TKFSGHYISYCKTPSGGWFRFDDEEVKPVSIKVVLQEEAYMLFYSKSEEKVSTTKEIKRG
AIENNNLEKLNTIVMKENEQNDKPTEIKEETVFINNIFKSSRIKSIHQLINQKYQPIKRK
PEEPQNNDLSGGKITSEEMEQKFKEKQVENDPIPMITIRKKDEKQQKKLDITGKPIKERK
GIETFDLRKIPFGLNYSERVEGWDDETEEIRKNVLRNKVGAIDKEKETHISKLDQYDINL
DKPKERKLRRNMKNAFKVEDKKFNPFQYQSDKKRHQKERERNEE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtctttagatgttgaacaacaaattcaacgtcaaattaatgaatttcttccaaaaaaa
ctgaaatttattaaaacagaaacaataaatccaacagcaaagaaaacaattagtattgat
aataggatagatgttgattatgatgatgctgaagaattaatgaaatggaaattaaaaaat
ggtaggaatgcagggagaggatattttaatgcacatagtaattgttatatgattagtgta
ttacaagtattaactcatacagcaccattttataattatatgacacaacaaaagattaaa
gtagatgatatattttttaaagaattagaacgaataatgaaagaagcgtttgaaaaaaat
aatcaaccattaaaaccaatagtatttgaaaaaaatttgaaaaaattatcttcatcatta
caaagatatcaacaagaagatgctacagaattttatttattattacttgatcatcttcat
gaagcaataattggaaaaggaaaaaataaaatatcagctattagtagtatatttcatgtt
gaattagtctcacgaattacatgttataattgtacaagatttaatgatcatgatgaacat
ttttctgtattacctattgaaataacaaaacaaaaaacacttgaaagtggatttgatcaa
ttctttaaaaaagaaatgatttctcattatcattgtgaaaagtgtaatacaaaatcaaat
gttagtaaatattatttctttaaaagattaccttggatattaccaattcaactaaaaaga
tttacttgggatgaaaagaaaattaatggaaaagtagcttttcctttacaacttaatatt
tcaaaatatggaatggatggattatatgatctttatgcaattgtggttcatcttggaaaa
acaaaatttagtggtcattatatttcttattgtaaaacaccaagtggtggttggtttaga
tttgatgatgaagaagttaaacctgtttcaattaaagtagtcttacaagaagaggcttac
atgctattctattctaaatcagaagagaaagttagtacaacaaaagaaataaaaagagga
gcaattgaaaataataacttagaaaaattgaatactattgttatgaaagaaaatgaacaa
aatgataaaccaactgaaataaaagaagaaactgtttttatcaataacatattcaagtct
tcaagaattaaatcaattcatcaactcataaatcaaaaatatcaaccaatcaaaagaaaa
cctgaagaacctcaaaataatgatctaagtggtggaaaaattacttcagaagaaatggaa
caaaagtttaaagagaaacaagtagaaaatgatccaattccaatgatcactatccgtaaa
aaagatgaaaagcaacaaaagaaattagacattactggaaaaccaatcaaagaaagaaaa
ggtattgaaacatttgatttaagaaaaatcccatttggtttaaattatagtgaacgtgtg
gaagggtgggatgatgagactgaagaaataagaaagaatgttttaagaaataaggttggt
gctattgataaagaaaaagaaactcatatcagtaaattagaccaatatgatattaattta
gataaaccaaaagaaagaaaacttagaagaaatatgaagaatgcatttaaagtagaagat
aaaaaatttaatcctttccaatatcagtcagataaaaaaagacaccaaaaagaaagagaa
agaaatgaagaataa

DBGET integrated database retrieval system