KEGG   Edwardsiella hoshinae: A9798_06390Help
Entry
A9798_06390       CDS       T04508                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00071  Fatty acid degradation
eho00072  Synthesis and degradation of ketone bodies
eho00280  Valine, leucine and isoleucine degradation
eho00310  Lysine degradation
eho00380  Tryptophan metabolism
eho00620  Pyruvate metabolism
eho00630  Glyoxylate and dicarboxylate metabolism
eho00640  Propanoate metabolism
eho00650  Butanoate metabolism
eho00900  Terpenoid backbone biosynthesis
eho01100  Metabolic pathways
eho01110  Biosynthesis of secondary metabolites
eho01120  Microbial metabolism in diverse environments
eho01130  Biosynthesis of antibiotics
eho01200  Carbon metabolism
eho01212  Fatty acid metabolism
eho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eho00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9798_06390
   00630 Glyoxylate and dicarboxylate metabolism
    A9798_06390
   00640 Propanoate metabolism
    A9798_06390
   00650 Butanoate metabolism
    A9798_06390
  Lipid metabolism
   00071 Fatty acid degradation
    A9798_06390
   00072 Synthesis and degradation of ketone bodies
    A9798_06390
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A9798_06390
   00310 Lysine degradation
    A9798_06390
   00380 Tryptophan metabolism
    A9798_06390
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A9798_06390
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A9798_06390
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A9798_06390
Enzymes [BR:eho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A9798_06390
Exosome [BR:eho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A9798_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOV96620
UniProt: A0A1D8MX86
Position
complement(1434179..1435363)
Genome map
AA seq 394 aa AA seqDB search
MKNIVIGSAVRSAIGNFGGAFSHLGAVALGAAVIEEAYARAALAPTMIDEVIMGNVLQTG
LGQNPARQAALKSGLPDSVTAYTVNKVCGSGLKSIALAAQAIQAGDATVIVAGGMENMSQ
APYILTHHARWGYRMGHHSLLDVIQQDGLTCAIEGYAMGVTAENIAKQYGISREAQDALA
LHSQQKACQAIAHGAFHAEIVPIPVTTRRVTQTIAQDEFPRADSTREALAKLSPVFAQQG
SVTAGNASGINDGAAALVIMEEQRAKTLGVQPLARIRSYASGGVSPALMGMGPVPACHNA
LKKAGLTLADIDLIEANEAFAAQFLAVGTQMGWDADKVNVNGGAIALGHPIGASGARIMV
TLLHALRARDKSLGLATLCIGGGQGIAMIVERLN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattgtgattggcagcgccgtacgcagcgctatcggtaatttcggtggtgca
ttttctcacctcggcgccgtcgcgctgggtgccgcagtgattgaggaggcgtacgcgcgg
gcagcgctggcgccgacgatgatcgacgaggtgattatggggaatgtgctacagaccgga
ctcggacaaaacccggcgcggcaagcggcgttaaaaagtggcctaccggacagcgtcacg
gcgtatacggtcaataaagtgtgcggctccggcctgaaaagtatcgccctggcggcccag
gctatccaagcgggcgatgccaccgtcatcgtcgctggcggcatggagaacatgagccaa
gccccctatatactgacacatcatgcgcgttggggataccggatgggccatcattcactg
ctggacgtcatccagcaagacggcctgacctgtgctatagagggttacgcgatgggggta
acggcggaaaatatcgccaaacagtatgggatcagccgtgaggcccaagacgcactggcc
ctgcactctcagcaaaaagcctgccaggccattgctcatggcgcatttcacgccgaaatt
gtgccgatcccagtcaccacgcgccgggttacccagacgatagcgcaggatgagttccct
cgcgccgatagcacgcgggaagcgttagccaagctctcaccggtctttgctcaacaggga
agtgtcacggcaggcaacgcctctggcattaatgatggcgctgccgcactggtaattatg
gaggagcaacgtgccaagacgctaggggttcagcccttggcacgcatacgtagctacgcc
agcggtggcgtctctccggccctgatgggcatgggaccggtgccggcctgccacaatgca
ctgaaaaaagccgggctcacacttgccgacattgacctgatcgaagcaaacgaagccttt
gccgcccaatttctggccgtaggcacccaaatgggctgggatgcggataaggtcaacgtg
aacggcggcgcgatcgctcttggccaccctatcggcgccagcggggcacgcatcatggtc
accctgttacatgcgctgcgcgcccgcgataagtctctgggactggccacgctctgtatc
ggcggcggtcaagggatagccatgatcgtagagcggcttaactga

DBGET integrated database retrieval system