KEGG   Enterococcus hirae: EHR_01575Help
Entry
EHR_01575         CDS       T02160                                 

Definition
glucosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ehr00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(287302..288744)
Genome map
AA seq 480 aa AA seqDB search
MTTKFSKDFLWGGATAANQLEGAYDQDGKGLSVADAMPGGKQRFAVIGSEDFDWTIQPDK
YTYPNHQGIDHYYRFKEDIALFAEMGFKCYRFSIAWTRIFPQGDEVTPNEKGLTFYEEVI
DECLKYGIEPVITISHYEMPLNLAKKYGGWKNRELIEFYERFAKVVLERFSDKVKYWMTF
NEINSAFHFPALSQGLVKSNGAADYQNIFQAWHNQFVASSKAVKIAHELREDSQVGCMII
YATTYSIDANPINQVATLIQNQEFNFFCADVQVRGKYPAYTNRTYEKYGVDSAKLEQTTE
DFELLQAYPVDYIGFSYYMSTAVNETDPDAAASAGNLLGGVKNPFLEASEWGWQIDPEGL
RIALNELYNRYEKPLFIVENGLGAIDKVEEDGRINDDYRIDYLRRHIEAMGEAVADGVEL
MGYTPWGCIDLVSASTGEMSKRYGFIYVDLDDEGNGTKNRSKKKSFEWYQKVIATNGEEL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaagttttcaaaagattttttatggggtggcgctacagctgccaatcaatta
gaaggtgcttacgatcaagatgggaaagggctctcagttgctgatgcgatgcctgggggg
aaacaacgatttgcagttattggcagtgaagactttgattggacgatccaaccagataaa
tatacctatcctaaccatcaagggatcgatcattattatcggttcaaagaagacattgcg
ctttttgctgaaatgggctttaaatgttatcgtttctccattgcttggactcggattttc
cctcaaggagacgaagtaacaccgaatgagaaaggcttaacgttttatgaagaagtgatt
gatgaatgtttgaaatatgggattgaacctgtgatcacgatttcccattacgagatgcca
ttaaatctagcaaaaaaatatggcggatggaaaaaccgagaactgattgaattttacgaa
cgctttgctaaagtggtgcttgaacgattcagcgataaagtcaaatattggatgacgttc
aatgagatcaattcagcttttcattttccagctttgagtcaaggattagtaaaaagtaat
ggtgcagctgattatcaaaatatcttccaagcatggcataaccaatttgtagcaagtagt
aaagcagtaaaaatcgctcatgaattacgggaggatagccaagtgggttgtatgattatc
tatgcaacgacgtatagcatagatgctaatccaatcaatcaagtagctacattgatccag
aaccaagaatttaatttcttctgtgcggatgttcaagtacggggcaaatacccggcatac
acaaaccgcacgtatgaaaaatatggcgtagatagtgccaaattagaacaaacgactgaa
gattttgagttgttgcaagcatatccagtcgactatatcggtttcagctattatatgtct
actgcagtcaacgaaacggacccagatgcagcggcctcagccggtaatcttttaggtgga
gttaaaaatccgttcttagaagccagtgaatggggatggcagattgatccagaaggttta
cggattgcattaaacgagttgtacaaccgttacgaaaaaccattgtttattgttgaaaat
gggttaggcgcaattgataaggtagaagaagacgggcgcatcaatgacgattaccgtatt
gattacttacgtcggcatatcgaagcaatgggagaagctgtggctgatggagtagaactc
atgggatatacgccatggggatgtattgatctggtaagtgcttcgactggtgaaatgagt
aaacgttatggatttatctatgttgatttggatgatgaagggaacggaaccaaaaatcgt
tcaaagaaaaaatcttttgagtggtatcaaaaagtcattgccaccaatggagaagaactg
taa

DBGET integrated database retrieval system