KEGG   Enterococcus hirae: EHR_01705Help
Entry
EHR_01705         CDS       T02160                                 

Definition
glucosyl hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ehr  Enterococcus hirae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EHR_01705
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EHR_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(313691..315469)
Genome map
AA seq 592 aa AA seqDB search
MNTFEIKEDFLLNGKPFKILSGAIHYFRVDSADWYHSLYNLKALGFNTVETYVPWNLHEP
KKGDFHFEGILDLEHFLSIAEELGLYAIVRPSPYICAEWEFGGFPAWLLNEGTRIRTNET
VYLNHVADYYDVLIKKIVPHQLTNGGNILMIQIENEYGSYGEEKDYLRSIRDLMLDRGIT
VPFFTSDGPWRATLRAGSMIDEDILVTGNFGSKAEENFSSMEAFFNEHGKKWPLMCMEFW
DGWFNRWKEPIVQRDAKELAEAIKEVVLRGSINLYMFHGGTNFGFMNGCSARGVIDLPQI
TSYDYGAPLDEQGNPTEKYYAIQTMIHETFPDIQQMEPLTKDTMEMKDIPLIDKVSLFST
LDTISQSVKMKYPETMEMLGQNTGYILYRTSIKKDAEHERLRVIDGRDRSQLFLNQKLQA
TQYQTEIGEDIIVPMPQEDNQLDILIENMGRVNYGHKLLADTQKKGIRTGVMADLHFITD
WNQYCLPLESCEKVDFSKEWHPNQPSFYRYEVTLDEVEDSFIDLSKFGKGVVFVNQTNIG
RFWEVGPTLSLYIPKSLFKKGNNEIVIFETEGTFQPEIQLVKAPLYKEMKEG
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacatttgagattaaagaagattttcttctaaacggtaagccctttaagatactc
tcaggagctatccactattttagagtggattcagccgattggtatcactcgttatataat
ctgaaagcattgggatttaatacagttgaaacttatgtaccatggaatctacatgaacct
aaaaaaggagatttccattttgagggaattttggacttagaacattttttgtccattgct
gaggaattaggactatacgcgattgttagaccatctccatatatttgtgcagaatgggag
tttggtggttttcctgcttggttacttaatgagggaactcggatccgaacaaatgaaacc
gtttatttgaaccatgtggcagattattatgatgttttaataaaaaaaatcgtgccgcat
cagctgacaaatggtggaaatattttaatgattcaaattgagaatgaatacggttcttat
ggagaagaaaaagactatttacgttcgatacgtgatttaatgttggacagaggaataaca
gtgccatttttcacttcggatggaccatggcgtgcgacactcagagcaggcagcatgatt
gatgaagatattttagttactggaaattttggttcaaaggctgaagaaaatttttcttca
atggaagctttcttcaatgagcatgggaaaaaatggcctttaatgtgtatggaattttgg
gatggttggtttaatcgttggaaggaaccgattgtacaacgtgatgcaaaagaattagct
gaggcaatcaaagaggtcgtgctgagaggaagtattaacctgtatatgttccatggagga
acaaattttggatttatgaatggttgctcagctagaggagtgattgatttgccacagatt
acttcttatgattacggagcacccttagacgagcaaggaaatccaaccgaaaaatattat
gcaatccagacaatgattcatgaaacgttccctgatatccaacaaatggaacctttgaca
aaagacacaatggaaatgaaagatattccattaattgataaagtcagtttattttcaaca
ttagatacaattagtcaatcagtaaaaatgaaatatccagaaacgatggaaatgttagga
caaaatacaggttatattctgtatcgcacctcaataaaaaaagatgcagaacatgaaaga
ctgagagtaatcgatggaagagaccgtagccaactatttttaaatcaaaaactgcaagct
acacaatatcagacagaaattggtgaagatatcattgttccaatgcctcaggaagacaat
caattagatattctaattgaaaatatggggcgtgttaattatggtcataaattattagcc
gatacacaaaaaaagggaattcgtacaggggtcatggctgatctacattttatcactgat
tggaatcagtattgtttaccactagagtcatgtgagaaagttgatttttcaaaggaatgg
catcctaaccagccaagtttttatcgctatgaagtaacacttgatgaagtggaggatagc
ttcattgatctatcaaaatttgggaaaggtgtcgtatttgttaatcagaccaatattgga
cgtttttgggaagttgggccaacactttcgctatatattccgaaaagcttatttaaaaaa
ggaaacaatgaaatagtgatttttgaaacagaaggaactttccaaccagagatccaatta
gtaaaagcaccactatataaagaaatgaaagaaggataa

DBGET integrated database retrieval system