KEGG   Enterococcus hirae: EHR_02045Help
Entry
EHR_02045         CDS       T02160                                 

Definition
mur ligase family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ehr  Enterococcus hirae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    EHR_02045
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EHR_02045
Enzymes [BR:ehr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     EHR_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379012..380364
Genome map
AA seq 450 aa AA seqDB search
MGVRSQFAIAVGKTSQWALKTFFKGGSSLPGKLALKIDPHILDSLAKDYQVVVVTGTNGK
TLTTALTVNILRQQFDEVLTNPTGANMVQGIVSTFLQAKPKKGQKKFAVLEIDEASLSKV
TEYMKPELFLFTNIFRDQMDRYGEIYTTYKMIVDGAAKSPDATIISNGDSPIFNSVETIN
PRQYYGFDHEEDHEQMAHYNTDGVLCPKCHHILHYKMITYANLGKYYCPNCDFKRPELDY
RLTDMLRMDNVSADFTIDGHNYGIEVGGMYNVYNALAATAVAEYFGVTPEKIKQGLGYDE
KIFGRQEIIDINGKKCTLVLVKNPVGINQVIDMIGLAPYPFSLVALLNANYADGIDVSWI
WDGNFEHFADMDIPAVIAGGDRHTDMSLRLKVAGIPEDKIIETKELNEVIKNIKQLPTEH
VYILATYTAVLQLRKELANQGFIKGGMNHA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgggagtacgcagtcaatttgcgattgctgttggtaaaacatcacaatgggcattaaaa
accttctttaaaggaggatcaagtttaccgggtaaacttgcacttaaaatcgacccacac
attttagacagtcttgcaaaagattatcaagtggttgtcgttactggaacaaacggaaag
acattgacaactgctttgacagttaatatattacggcaacaatttgatgaagtattaacc
aacccaactggggcaaatatggttcaaggaatcgtttctacttttttgcaagccaaacct
aaaaaagggcaaaaaaaattcgctgttttagaaatcgatgaagcaagtttgagtaaagta
actgaatacatgaagcctgaactatttttatttacaaacattttccgtgatcaaatggat
cgttatggagaaatctataccacctacaaaatgattgtagacggagcagcgaaatcaccc
gatgccacaattatcagtaacggagattcgccaatcttcaactctgtggaaacaatcaat
cctcgccaatattatgggtttgatcatgaagaagaccatgaacaaatggctcattataat
acggatggtgtgctctgtcctaaatgtcatcatattttacattacaagatgatcacgtat
gcaaatttagggaaatactattgtccaaactgtgactttaaacgtcctgaacttgattat
cgtctaacggatatgttgcgcatggacaatgtctcagctgattttacgattgatggtcat
aactatggaattgaagttggcgggatgtacaatgtctacaacgcgttagctgccacagcg
gtagctgaatattttggggtaacccctgaaaaaatcaagcaaggcctaggatacgacgaa
aaaatatttggtcgtcaagaaatcattgatatcaatggtaaaaaatgtacactcgtactt
gttaaaaatcctgttggaatcaatcaggtcatcgatatgatcggcttagccccttatcca
ttctcactagttgctttattaaatgcaaactatgcagatggaattgacgttagttggatc
tgggacggaaattttgaacattttgctgatatggatattcctgcagtgatcgctggtggg
gatcgtcataccgatatgtcgttacgtctaaaagttgcaggaatccctgaagataagatc
atcgaaacaaaggaactgaatgaagtcattaaaaatatcaaacaattaccgaccgaacac
gtctacatcctagctacctatacagcagttcttcaattacgaaaagaattagcgaatcaa
ggatttatcaaaggagggatgaatcatgcctaa

DBGET integrated database retrieval system