KEGG   Enterococcus hirae: EHR_02125Help
Entry
EHR_02125         CDS       T02160                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ehr  Enterococcus hirae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EHR_02125
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     EHR_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(395991..396899)
Genome map
AA seq 302 aa AA seqDB search
MNTVTVIGSINLDRTIRVKHMPKPGETIHTKETFSAGGGKGANQAVAARRSEATTHFIGA
IGTDEAGKTMAELLEQEEINLQGVATLENQATGQAYIIVDDAGENSIMIHAGANNAFTPE
QVRQNKAIIEKSDFIIAQFESAVESTIEAFNLAKEVGVKTILNPAPALENVPEELLKVTD
MIIPNETETEILTGISITDEESLKQAAAHLHQLGIEVVIITIGSKGAFYSIKNSKNGIVP
AFKVNAVDTTAAGDTFIGAMSSMLATDFSNLEEAITYGNKASSLTVQRFGAQPSIPYKQE
LN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgtaacagttatcggtagcattaatttagatcggaccatccgagtcaaacat
atgcctaagccaggagaaacgatccacacgaaagaaacattttcagctggcggaggaaaa
ggagcaaaccaagcagttgctgcaagacgttcagaagctactactcattttattggagcg
attggtaccgatgaagctggcaaaacaatggctgagcttttagaacaagaagaaatcaat
ttacaaggtgtagcaactcttgaaaaccaagcgactggtcaagcttacatcattgttgat
gatgctggggaaaatagtattatgatccatgccggagcgaacaatgcgtttacaccagaa
caagttagacaaaacaaagcgatcatcgaaaaaagtgattttatcattgcacagtttgaa
agcgctgtagaaagtacgattgaagcttttaacctagcaaaagaggttggagtaaaaaca
attttgaatcctgccccagcattagaaaatgtgcctgaagagttattgaaagtaacagat
atgattattcctaatgaaacagaaacagaaattttaacagggatttcgattacggacgaa
gaaagcttaaaacaggctgcagctcacttacatcaattaggaatcgaagttgtaattatc
acgatcggaagtaaaggcgcattttactcgattaaaaacagcaaaaatgggatcgtgcca
gcgttcaaagtgaatgcagtcgatacgacagctgcaggtgatacattcattggtgcgatg
agtagcatgttagcaactgattttagtaatttagaggaagcaattacctatggaaataaa
gcttcttctttgactgttcaacgttttggcgcacaaccttctattccatataaacaagaa
ttgaattaa

DBGET integrated database retrieval system