KEGG   Enterococcus hirae: EHR_03695Help
Entry
EHR_03695         CDS       T02160                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EHR_03695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_03695
   00620 Pyruvate metabolism
    EHR_03695
   00650 Butanoate metabolism
    EHR_03695
  Lipid metabolism
   00071 Fatty acid degradation
    EHR_03695
  Amino acid metabolism
   00350 Tyrosine metabolism
    EHR_03695
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EHR_03695
   00626 Naphthalene degradation
    EHR_03695
Enzymes [BR:ehr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EHR_03695
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EHR_03695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(689102..691699)
Genome map
AA seq 865 aa AA seqDB search
MAKVMEKEQPKTIDVQGMIDELATKANVALKEMENFDQEKVDHIVHEMAMAALDQHMPLA
KMAVEETGRGIYEDKAIKNMYASEYIWNNIKHDKTVGVINEDVQKGLIEIAEPVGVVCGV
TPTTNPTSTTIFKSMIALKTRNPIVFAFHPSAQKSSAEAARVVRDAAIAAGAPENCIQWI
EHPSIEATSMLMNHPGIAIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKIKRA
VNDLIVSKTFDNGMICASEQAVIVDKEVYAAVKAEFQAHQVYFVKPAELSKLEDAVMNEG
KYAVNPAIVGHSAMDIAKLAGIKVPEGTKMLVAELEGVGADYPLSREKLSPVLAMVKANN
TEHAFELCEGMLNLGGLGHTAVIHSEDEELHVKFGLRMKACRILVNTPSAEGGIGNIYNE
MIPSLTLGCGSYGKNSVSRNVSAINLINVKTVAKRRNNMQWFKLPPKIFFEKNSLLYLEK
MENVERVMIVCDPGMVQFGYCDTVREVLSRRKNDVKIEVFSEVEPNPSTNTVYAGTKLMA
DFKPDTVIALGGGSAMDAAKGMWMFYEHPDTSFFGAKQKFLDIRKRTYKIDKPEKTQFVC
IPTTSGTGSEVTPFAVITDSDTHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDV
LTHAIESYVSVMASDYTRGLSLQAIKLVFDYLEKSVKTPDMESREKMHNASTMAGMAFAN
AFLGICHSVAHKIGGEYGIPHGRTNAILLPHIIRYNAKDPQKHAMFPKYDYFRADTDYAD
IAKFLGLKGQTTAELVEALATAVYELGQSVGINMSLKAQGVTQETLDSTVDRMAELAYED
QCTTANPKEPLISELKQIIIDAYNG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagtaatggagaaagaacaaccaaaaactattgatgttcaaggaatgattgat
gaattagcaacgaaagcaaatgtcgcattaaaagagatggaaaactttgatcaagaaaaa
gtagatcatattgtgcatgaaatggcaatggcagcattagatcaacatatgccgttagct
aaaatggcagttgaagaaactggtcgtggaatctatgaagataaagcgatcaaaaatatg
tatgcttctgaatatatttggaataacatcaagcacgataaaacagttggtgtcatcaat
gaagatgttcaaaaaggcttgattgaaattgctgaaccagttggtgtggtttgtggggta
actccaacaactaacccaacatcaacgacaatttttaaatcaatgatcgcgttgaaaaca
agaaacccaatcgtttttgcattccatccaagtgctcaaaaatcttctgctgaagcagcg
cgtgtcgttcgtgatgcagcgatcgcagctggcgcacctgaaaattgtattcaatggatt
gaacatccatcgattgaagcgacttcaatgttgatgaatcatccagggatcgcaattgtt
ttagctactggtggggcgggaatggtaaaatctgcttattcaacaggaaagccagcttta
ggtgttggaccaggtaatgtaccagcatatattgaaaaaacagcaaaaatcaaacgagca
gtgaatgacttgatcgtttctaaaacgttcgataacggaatgatttgtgcttctgagcaa
gcagtaatcgttgacaaagaagtctatgctgcagttaaagcagaattccaagcacatcaa
gtctattttgtgaaaccagctgaactttcaaaattagaagatgcagtgatgaatgaaggt
aaatacgcagtaaatccagcaatcgttggacattctgcaatggacattgcaaaactagct
ggcatcaaagttccagaagggacaaaaatgttagtagctgaattagaaggtgtcggagcg
gattaccctctttcacgtgaaaaactttctccagtacttgcaatggttaaagcaaacaat
acagaacatgcctttgaattatgcgaaggaatgttgaacttaggcgggttaggccatact
gcagtgattcactcagaggatgaagagctgcatgtgaagtttggtctacggatgaaagct
tgccgtatcttagtaaatactccttcagcagaaggtggaatcggaaatatctataacgaa
atgatcccttcactaactttaggttgtggttcatatggtaaaaattctgtttctagaaat
gtaagtgccatcaacttgatcaatgtcaaaactgtagcgaaacggagaaataatatgcaa
tggttcaaattaccaccaaaaatcttctttgaaaagaactctttgctttatttagaaaaa
atggaaaacgtagagcgtgtcatgatcgtttgtgatcctggtatggtgcagtttggttac
tgtgatacggttcgtgaagtactatcaagacgtaaaaatgatgtgaaaatcgaagtcttc
tcagaagttgagccaaatccttcaacaaacacagtctatgcaggaacgaaattgatggct
gatttcaaaccagacacagtgattgcattaggtggcggttctgcaatggatgctgctaaa
ggaatgtggatgttctatgaacacccagatacttcattctttggagcaaaacaaaaattc
ttagatatccgtaaacggacatataagatcgataaaccagaaaaaacacaatttgtgtgt
attccgacaacttcaggaacgggttctgaagtaacaccttttgccgttatcacagatagt
gatacacatgtgaaatatccattggcagattatgcattaacaccagatgtagcaatcgtc
gacccacaatttgtcatgtcagtaccagcttctgtcacggcagatacagggatggacgta
ttaactcatgcgattgagtcttatgtttctgttatggcttctgattatacaagaggattg
agcttacaagcaatcaaattagtcttcgattacctagaaaaatcagtgaaaactcctgat
atggaatcacgagaaaaaatgcacaacgcttctacaatggcagggatggcatttgcgaac
gccttcttaggaatttgtcactcagttgcgcataaaattggtggagaatatggtatccca
catggtcgtacaaatgccattttattaccacatatcatccgctataatgcaaaagatcca
caaaaacatgcaatgttccctaaatatgattacttccgtgcagatacagactatgcagat
attgctaagttcttagggttaaaaggacaaacaacagcggaattagttgaagctttagca
acagcagtttatgaattaggacaatcagttggaatcaatatgagcttgaaggctcaaggt
gtgacacaagaaaccttagattcaacggttgaccgtatggcagaacttgcttatgaagat
caatgtacaacagcaaatccaaaagagccattgatcagtgagctaaaacaaatcattatt
gatgcttataatggttaa

DBGET integrated database retrieval system