KEGG   Enterococcus hirae: EHR_04655Help
Entry
EHR_04655         CDS       T02160                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_04655
   01230 Biosynthesis of amino acids
    EHR_04655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_04655
  Energy metabolism
   00680 Methane metabolism
    EHR_04655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EHR_04655
Enzymes [BR:ehr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EHR_04655
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EHR_04655
  Exosomal proteins of melanoma cells
   EHR_04655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
874027..874713
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNLILEHSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDDQVHIWRRSYDTL
PPLMDESDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggtcttagtgaatggaatgcattaaaccaattt
actggttgggctgacgtaaacttagcaccagaaggaatcgaagaagccaaagaaggcgga
cgcaaaatcaaagaagctggaattgaatttgatgttgcttacacttcagttttaactcgt
gccatcaaaacatgtaatttgattttagaacactcagatcaactttgggttcctcaaatc
aaatcatggcgcttaaacgaacgtcattatggtaaattacaaggattgaacaaaaaagaa
acagctgaaaaatatggagatgaccaagtacacatttggcgtcgttcatacgacactctt
cctccattgatggacgaaagtgacgaaggttctgctgcaaacgatcgtcgttatgcaatg
ttagacaaacgcgatattcctggtggcgaaaacttgaaagttactttagaacgtgcttta
ccattctggcaagacgaaattgctccagctttactagacaacaaaactgttttagtagct
gcacatggtaactctctacgtgctttagcaaaacacatcgaaggaatttctgatgaagat
atcatggatcttgaaattccaactggtcaaccacttgtttatgaattaaacgatgacttg
acagttgctaaaaaatactatttataa

DBGET integrated database retrieval system