KEGG   Enterococcus hirae: EHR_04655Help
Entry
EHR_04655         CDS       T02160                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_04655
   01230 Biosynthesis of amino acids
    EHR_04655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_04655
  Energy metabolism
   00680 Methane metabolism
    EHR_04655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EHR_04655
Enzymes [BR:ehr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EHR_04655
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EHR_04655
  Exosomal proteins of melanoma cells
   EHR_04655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
874027..874713
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNLILEHSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDDQVHIWRRSYDTL
PPLMDESDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggtcttagtgaatggaatgcattaaaccaattt
actggttgggctgacgtaaacttagcaccagaaggaatcgaagaagccaaagaaggcgga
cgcaaaatcaaagaagctggaattgaatttgatgttgcttacacttcagttttaactcgt
gccatcaaaacatgtaatttgattttagaacactcagatcaactttgggttcctcaaatc
aaatcatggcgcttaaacgaacgtcattatggtaaattacaaggattgaacaaaaaagaa
acagctgaaaaatatggagatgaccaagtacacatttggcgtcgttcatacgacactctt
cctccattgatggacgaaagtgacgaaggttctgctgcaaacgatcgtcgttatgcaatg
ttagacaaacgcgatattcctggtggcgaaaacttgaaagttactttagaacgtgcttta
ccattctggcaagacgaaattgctccagctttactagacaacaaaactgttttagtagct
gcacatggtaactctctacgtgctttagcaaaacacatcgaaggaatttctgatgaagat
atcatggatcttgaaattccaactggtcaaccacttgtttatgaattaaacgatgacttg
acagttgctaaaaaatactatttataa

DBGET integrated database retrieval system