KEGG   Enterococcus hirae: EHR_04655Help
Entry
EHR_04655         CDS       T02160                                 

Definition
(GenBank) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ehr  Enterococcus hirae
Pathway
ehr00010  Glycolysis / Gluconeogenesis
ehr00260  Glycine, serine and threonine metabolism
ehr00680  Methane metabolism
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01120  Microbial metabolism in diverse environments
ehr01130  Biosynthesis of antibiotics
ehr01200  Carbon metabolism
ehr01230  Biosynthesis of amino acids
Module
ehr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ehr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_04655
  Energy metabolism
   00680 Methane metabolism
    EHR_04655
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EHR_04655
Enzymes [BR:ehr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EHR_04655
Membrane trafficking [BR:ehr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EHR_04655
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EHR_04655
  Exosomal proteins of melanoma cells
   EHR_04655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFM69894
UniProt: I6T9H9
Position
874027..874713
Genome map
AA seq 228 aa AA seqDB search
MPKLVFSRHGLSEWNALNQFTGWADVNLAPEGIEEAKEGGRKIKEAGIEFDVAYTSVLTR
AIKTCNLILEHSDQLWVPQIKSWRLNERHYGKLQGLNKKETAEKYGDDQVHIWRRSYDTL
PPLMDESDEGSAANDRRYAMLDKRDIPGGENLKVTLERALPFWQDEIAPALLDNKTVLVA
AHGNSLRALAKHIEGISDEDIMDLEIPTGQPLVYELNDDLTVAKKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagttttttctcgtcatggtcttagtgaatggaatgcattaaaccaattt
actggttgggctgacgtaaacttagcaccagaaggaatcgaagaagccaaagaaggcgga
cgcaaaatcaaagaagctggaattgaatttgatgttgcttacacttcagttttaactcgt
gccatcaaaacatgtaatttgattttagaacactcagatcaactttgggttcctcaaatc
aaatcatggcgcttaaacgaacgtcattatggtaaattacaaggattgaacaaaaaagaa
acagctgaaaaatatggagatgaccaagtacacatttggcgtcgttcatacgacactctt
cctccattgatggacgaaagtgacgaaggttctgctgcaaacgatcgtcgttatgcaatg
ttagacaaacgcgatattcctggtggcgaaaacttgaaagttactttagaacgtgcttta
ccattctggcaagacgaaattgctccagctttactagacaacaaaactgttttagtagct
gcacatggtaactctctacgtgctttagcaaaacacatcgaaggaatttctgatgaagat
atcatggatcttgaaattccaactggtcaaccacttgtttatgaattaaacgatgacttg
acagttgctaaaaaatactatttataa

DBGET integrated database retrieval system