KEGG   Enterococcus hirae: EHR_05285Help
Entry
EHR_05285         CDS       T02160                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ehr  Enterococcus hirae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHR_05285
   01230 Biosynthesis of amino acids
    EHR_05285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_05285
   00051 Fructose and mannose metabolism
    EHR_05285
   00562 Inositol phosphate metabolism
    EHR_05285
Enzymes [BR:ehr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EHR_05285
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EHR_05285
  Exosomal proteins of bladder cancer cells
   EHR_05285
  Exosomal proteins of melanoma cells
   EHR_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010997..1011692
Genome map
AA seq 231 aa AA seqDB search
MRTVRKPFFVVNPKSYLYGEQALELAKTADQLAAAYDIDIIFTCQHVDVRLIKEQTTQLI
VSVQHIDGIAPGRGMGHVLPEGVVAAGAEATFLNHAERPLSVSELCDAVKRAKELGLLTI
VCANSLEEAKLVASLKPDVMVCEPTELIGTGQASDISYMIQTNEAVRKMDPEIFVLQAAG
ISTVADVRKALDSGADATGGTSGIVCAKDPVDTLKAMIEEVSKWKKEQSTK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtaagaaaaccattttttgtggttaatcctaaatcttatttgtatggtgaa
caggcattggaactagcaaaaacagcggatcaattagctgcagcatacgacatcgatatc
atttttacttgtcaacatgttgatgttcggctaattaaagaacagacaacgcagttgatt
gtgagtgttcaacatatcgatgggatagcccctggtagagggatgggacacgttttacct
gaaggcgttgtagcggctggagcagaagcgaccttccttaatcacgcagaacgtccttta
tcggttagtgagctgtgcgatgccgtcaagcgagcaaaggaacttggtctattgactatt
gtttgtgcaaattctttagaagaggcgaagctcgtagcttccttgaaacctgatgtgatg
gtttgtgagcctacggaattaataggtacaggtcaagcaagtgacatttcttatatgatt
caaaccaatgaagctgtacgcaagatggatcctgaaatttttgttctgcaggcagcaggg
atttcaacggtagcagatgttcgcaaagcacttgattcgggggctgatgcaacgggtgga
accagcgggattgtttgtgccaaagatcctgtggacacattgaaagcgatgattgaagaa
gtaagtaaatggaaaaaggagcaatcgacaaaatga

DBGET integrated database retrieval system