KEGG   Enterococcus hirae: EHR_05455Help
Entry
EHR_05455         CDS       T02160                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ehr  Enterococcus hirae
Pathway
ehr00330  Arginine and proline metabolism
ehr00332  Carbapenem biosynthesis
ehr01100  Metabolic pathways
ehr01130  Biosynthesis of antibiotics
ehr01230  Biosynthesis of amino acids
Module
ehr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EHR_05455
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    EHR_05455
Enzymes [BR:ehr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EHR_05455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase GTP1_OBG
Motif
Other DBs
NCBI-ProteinID: AFM70044
UniProt: I6T9W0
Position
complement(1042112..1042918)
Genome map
AA seq 268 aa AA seqDB search
MRKEVTKAKRIVIKVGTSTLIYPNGNINLAAIDQLAFVLSDLRNQGKEVVLVSSGAVGVG
MHKMNQATRPTTIPEQQAIAAIGQAELMNIYNQRFSVYNQQTAQILVTRDVIDFPQSRVN
VINTLEQLLAMGTIPIVNENDTVAVDELEHTTKFGDNDQLSAIVTKLITADLLIVLSDID
GFYSADPSKNPDAKMYQTVSVIDECLMAQAGGAGSTFGTGGMSSKLQAALRIFEANSTMI
LANGKNPTIIFDLLAGKELGTLFKEEHV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaagaagttacaaaagccaaacgaattgttattaaagtgggaacgagtacttta
atctatcccaatggaaacatcaacctcgctgcgattgatcagcttgcctttgtcttgtct
gatcttcggaatcaagggaaagaagtcgtattagtttcatccggcgctgttggtgtcggg
atgcacaaaatgaatcaagctacacgccccacaacgatcccggaacaacaagcaattgct
gcgatcggacaggcagaattgatgaacatttataatcaacgtttcagtgtttacaatcag
caaacagctcagatcctcgttactcgggatgtgatcgattttcctcaaagtcgagtcaat
gtgatcaacacacttgaacagttattagcaatgggaaccatcccgatcgttaatgaaaat
gatactgtagcagtcgatgaacttgaacatacaacgaaatttggtgataatgatcaacta
tctgcgatcgttacaaaattgatcacagcagatttattaattgttttatctgatattgac
ggattttattccgccgatccttcaaaaaatccagacgcaaagatgtatcaaaccgtttcg
gtcattgacgagtgtttaatggcacaagcgggtggtgctggcagcacctttggaacagga
ggaatgtctagtaagttacaagcagcattacgtatttttgaagccaacagtacaatgatc
ctggcaaacggaaaaaatcctaccattatcttcgatcttttagccggtaaagaacttgga
accttatttaaggaggaacacgtatga

DBGET integrated database retrieval system