KEGG   Enterococcus hirae: EHR_05480Help
Entry
EHR_05480         CDS       T02160                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K09698  nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ehr  Enterococcus hirae
Pathway
ehr00970  Aminoacyl-tRNA biosynthesis
ehr01100  Metabolic pathways
Module
ehr_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    EHR_05480
Enzymes [BR:ehr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     EHR_05480
Amino acid related enzymes [BR:ehr01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   EHR_05480
Transfer RNA biogenesis [BR:ehr03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EHR_05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AFM70049
UniProt: I6T9W6
Position
1046481..1047941
Genome map
AA seq 486 aa AA seqDB search
MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEDGEKSQLE
NLAWLGIDWDESPENPGEYGPYRQSERKEIYQPLIDQLLASNRAYKCYCTEEELEATREE
QRARGEMPHYAGTCANLTPEEQAEKEAQGIEPVIRFRVPRNTEYAFKDMVKGDITFESDN
IGGDYVIQKRDGMPTYNFAVAVDDHMMKITHVLRGDDHIANTPKQLMIYEAFGWTPPTFG
HMTLIINTETGKKLSKRDESILQFIEQYRELGYLPEAMFNFIALLGWSPVGEDEIFNQEE
LINMFDPNRLSKSPAAFDAKKLQWVNNHYMKEMDLDKLTDMCLPYLIADGRVQENPDEKT
IEWVKRIVSLYQPQMSYAAEIVEASSLFFNEHPVLNDAAKEVLAGETVPLVLNAFKAQLE
QMEVVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPDTIELLGREKSLAH
LNQVIN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtacgcgtacgctatgcaccaagtccaactgggcacttacatattgggaat
gctcgaacagcattgttcaattatctatttgctcgccacaacgatggagactttattatt
cgtattgaggacacagaccaaaaacgaaacattgaagatggtgaaaagagccaattggaa
aatttggcttggttaggtatcgattgggatgaatctcctgaaaatcctggagaatatggt
ccttatcgtcaatctgaaagaaaagaaatttatcagcctttgattgatcaacttcttgca
agtaatcgggcatacaaatgttactgtacagaagaagagttagaagcaactcgtgaagaa
caacgtgcacgtggagaaatgcctcattatgcgggtacttgtgcaaatctaacaccagaa
gaacaagcagaaaaagaagcgcaagggattgaaccagtgatccgattccgtgtaccacgt
aatacggaatatgcgttcaaagatatggtcaaaggggatatcacctttgaatcagataat
atcggtggcgactatgtcattcaaaaacgtgatggtatgccaacatataactttgctgta
gctgtagatgatcatatgatgaagattactcatgtcttacgtggggatgaccatattgca
aatacacctaaacaattgatgatctatgaagcttttggttggacaccaccaacattcggt
cacatgacattgatcatcaatacagaaactgggaaaaaactaagtaaacgtgatgaatcg
attttacaatttatcgaacagtatcgtgaattaggttacttaccagaagcaatgttcaac
tttattgcattattaggttggtcaccagtaggcgaagacgaaattttcaaccaagaagaa
ttgatcaacatgtttgatccaaatcgtttgagtaaatcacctgcagccttcgatgcgaag
aaattacaatgggtgaataaccattacatgaaagaaatggatttagataagttaacagac
atgtgcttgccttacttgatcgctgacggtcgagtacaagaaaatcctgatgaaaaaacg
atcgaatgggtcaaaagaatcgttagtctgtatcaaccacaaatgagttacgcagctgaa
atcgtagaagcttcttccttattcttcaatgaacatcctgtattgaacgatgcggctaaa
gaagtattagcaggcgaaactgttccacttgttcttaatgcatttaaagcacaactagaa
caaatggaagtcgtggatgccccaaccgtaaaagcagcaatcaaagctgtccaaaaagaa
actggcgttaaaggtaaaaatcttttcatgccgatccgagtagctgtttcaggacaaatg
cacggaccagaattaccagatacgatcgaattgcttggtcgtgaaaaatcattagcacat
ttaaatcaagtcatcaactaa

DBGET integrated database retrieval system