KEGG   Enterococcus hirae: EHR_05480Help
Entry
EHR_05480         CDS       T02160                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
ehr  Enterococcus hirae
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ehr00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046481..1047941
Genome map
AA seq 486 aa AA seqDB search
MTKVRVRYAPSPTGHLHIGNARTALFNYLFARHNDGDFIIRIEDTDQKRNIEDGEKSQLE
NLAWLGIDWDESPENPGEYGPYRQSERKEIYQPLIDQLLASNRAYKCYCTEEELEATREE
QRARGEMPHYAGTCANLTPEEQAEKEAQGIEPVIRFRVPRNTEYAFKDMVKGDITFESDN
IGGDYVIQKRDGMPTYNFAVAVDDHMMKITHVLRGDDHIANTPKQLMIYEAFGWTPPTFG
HMTLIINTETGKKLSKRDESILQFIEQYRELGYLPEAMFNFIALLGWSPVGEDEIFNQEE
LINMFDPNRLSKSPAAFDAKKLQWVNNHYMKEMDLDKLTDMCLPYLIADGRVQENPDEKT
IEWVKRIVSLYQPQMSYAAEIVEASSLFFNEHPVLNDAAKEVLAGETVPLVLNAFKAQLE
QMEVVDAPTVKAAIKAVQKETGVKGKNLFMPIRVAVSGQMHGPELPDTIELLGREKSLAH
LNQVIN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtacgcgtacgctatgcaccaagtccaactgggcacttacatattgggaat
gctcgaacagcattgttcaattatctatttgctcgccacaacgatggagactttattatt
cgtattgaggacacagaccaaaaacgaaacattgaagatggtgaaaagagccaattggaa
aatttggcttggttaggtatcgattgggatgaatctcctgaaaatcctggagaatatggt
ccttatcgtcaatctgaaagaaaagaaatttatcagcctttgattgatcaacttcttgca
agtaatcgggcatacaaatgttactgtacagaagaagagttagaagcaactcgtgaagaa
caacgtgcacgtggagaaatgcctcattatgcgggtacttgtgcaaatctaacaccagaa
gaacaagcagaaaaagaagcgcaagggattgaaccagtgatccgattccgtgtaccacgt
aatacggaatatgcgttcaaagatatggtcaaaggggatatcacctttgaatcagataat
atcggtggcgactatgtcattcaaaaacgtgatggtatgccaacatataactttgctgta
gctgtagatgatcatatgatgaagattactcatgtcttacgtggggatgaccatattgca
aatacacctaaacaattgatgatctatgaagcttttggttggacaccaccaacattcggt
cacatgacattgatcatcaatacagaaactgggaaaaaactaagtaaacgtgatgaatcg
attttacaatttatcgaacagtatcgtgaattaggttacttaccagaagcaatgttcaac
tttattgcattattaggttggtcaccagtaggcgaagacgaaattttcaaccaagaagaa
ttgatcaacatgtttgatccaaatcgtttgagtaaatcacctgcagccttcgatgcgaag
aaattacaatgggtgaataaccattacatgaaagaaatggatttagataagttaacagac
atgtgcttgccttacttgatcgctgacggtcgagtacaagaaaatcctgatgaaaaaacg
atcgaatgggtcaaaagaatcgttagtctgtatcaaccacaaatgagttacgcagctgaa
atcgtagaagcttcttccttattcttcaatgaacatcctgtattgaacgatgcggctaaa
gaagtattagcaggcgaaactgttccacttgttcttaatgcatttaaagcacaactagaa
caaatggaagtcgtggatgccccaaccgtaaaagcagcaatcaaagctgtccaaaaagaa
actggcgttaaaggtaaaaatcttttcatgccgatccgagtagctgtttcaggacaaatg
cacggaccagaattaccagatacgatcgaattgcttggtcgtgaaaaatcattagcacat
ttaaatcaagtcatcaactaa

DBGET integrated database retrieval system